msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: 2007-11-21 19:03+0100\n" "Last-Translator: Chronos \n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=windows-1250\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts:liserrinvalidoption msgid "Invalid option at position %d: \"%s\"" msgstr "Nesprávná volba na pozici %d: \"%s\"" #: lazarusidestrconsts:liserrnooptionallowed msgid "Option at position %d does not allow an argument: %s" msgstr "Volba na pozici %d nepovoluje argument: %s" #: lazarusidestrconsts:liserroptionneeded msgid "Option at position %d needs an argument : %s" msgstr "Volba na pozici %d potřebuje argument : %s" #: lazarusidestrconsts:lisentertransla msgid "Enter translation language" msgstr "Zadejte překladový jazyk" #: lazarusidestrconsts:lislazarusversionstring msgid "%s beta" msgstr "%s beta" #: lazarusidestrconsts:lisleaveemptyfo msgid "Leave empty for default .po file" msgstr "Nechejte prázdné pro implicitní .po soubor" #: lazarusidestrconsts:lismenucollectpofil msgid "Collect .po files" msgstr "Sesbírat soubory .po" #: lazarusidestrconsts:lismenucreatepofile msgid "Create .po files" msgstr "Vytvořit .po soubory" #: lazarusidestrconsts:listhishelpmessage msgid "this help message" msgstr "tato zprává nápovědy" #: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " msgstr "hlavní konfigurační složka, kde Lazarus uchovává své konfigurační soubory. Implicitní je " #: lazarusidestrconsts:lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [volby] " #: lazarusidestrconsts:lisideoptions msgid "IDE Options:" msgstr "Volby IDE:" #: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "Volby rozhraní LCL:" #: lazarusidestrconsts:lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "Nezobrazovat úvodní obrázek při startu" #: lazarusidestrconsts:lisskiploadinglastproject msgid "Skip loading last project" msgstr "Přeskočit načtení posledního projektu" #: lazarusidestrconsts:lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varinaty se podívejte na soubory ve složce jazyků." #: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " msgstr "druhotná konfigurační složka, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je " #: lazarusidestrconsts:lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "" #: lazarusidestrconsts:lisselectiontool msgid "Selection tool" msgstr "Nástroj výběru" #: lazarusidestrconsts:liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Sloupec kurzoru v aktuálním editoru" #: lazarusidestrconsts:liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "Řádek kurzoru v aktuálním editoru" #: lazarusidestrconsts:liscompilerfilename msgid "Compiler filename" msgstr "Jméno souboru překladače" #: lazarusidestrconsts:liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Slovo na pozici kurzoru v aktuálním editoru" #: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "" #: lazarusidestrconsts:lisfreepascalsourcedirectory msgid "Freepascal source directory" msgstr "Zdrojová složka Freepascalu" #: lazarusidestrconsts:lislazarusdirectory msgid "Lazarus directory" msgstr "Složka Lazarusu" #: lazarusidestrconsts:lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "ID jazyka Lazarusu (např. en, de, br, cz)" #: lazarusidestrconsts:lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "Jméno jazyka Lazarusu (např. english, czech)" #: lazarusidestrconsts:lislclwidgettype msgid "LCL Widget Type" msgstr "" #: lazarusidestrconsts:liscovarious msgid "%s (various)" msgstr "%s (různé)" #: lazarusidestrconsts:listargetcpu msgid "Target CPU" msgstr "" #: lazarusidestrconsts:listargetos msgid "Target OS" msgstr "" #: lazarusidestrconsts:liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "" #: lazarusidestrconsts:lispromptforvalue msgid "Prompt for value" msgstr "" #: lazarusidestrconsts:lisprojectfilename msgid "Project filename" msgstr "Jméno souboru projektu" #: lazarusidestrconsts:lisprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts:lissavecurrenteditorfile msgid "save current editor file" msgstr "" #: lazarusidestrconsts:lissaveallmodified msgid "save all modified files" msgstr "" #: lazarusidestrconsts:listargetfilenameofproject msgid "Target filename of project" msgstr "" #: lazarusidestrconsts:listargetfilenameplusparams msgid "Target filename + params" msgstr "" #: lazarusidestrconsts:listestdirectory msgid "Test directory" msgstr "Testovací složka" #: lazarusidestrconsts:lislaunchingcmdline msgid "Launching target command line" msgstr "" #: lazarusidestrconsts:lispublishprojdir msgid "Publish project directory" msgstr "" #: lazarusidestrconsts:lisprojectunitpath msgid "Project Unit Path" msgstr "" #: lazarusidestrconsts:lisprojectincpath msgid "Project Include Path" msgstr "" #: lazarusidestrconsts:lisprojectsrcpath msgid "Project Src Path" msgstr "" #: lazarusidestrconsts:lismakeexe msgid "Make Executable" msgstr "" #: lazarusidestrconsts:lisprojectmacroproperties msgid "Project macro properties" msgstr "" #: lazarusidestrconsts:lisopenproject2 msgid "Open project" msgstr "" #: lazarusidestrconsts:liskmsaveproject msgid "Save project" msgstr "" #: lazarusidestrconsts:liskmcloseproject msgid "Close project" msgstr "" #: lazarusidestrconsts:liskmsaveprojectas msgid "Save project as" msgstr "" #: lazarusidestrconsts:liskmpublishproject msgid "Publish project" msgstr "" #: lazarusidestrconsts:lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "" #: lazarusidestrconsts:lisopenasxmlfile msgid "Open as XML file" msgstr "" #: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgstr "Při posledním startu došlo k chybě při načítání %s!%s%sNačíst znovu tento projekt?" #: lazarusidestrconsts:lisopenprojectagain msgid "Open project again" msgstr "" #: lazarusidestrconsts:lisstartwithanewproject msgid "Start with a new project" msgstr "" #: lazarusidestrconsts:lisprojectmacrounitpath msgid "macro ProjectUnitPath" msgstr "" #: lazarusidestrconsts:lisconfigdirectory msgid "Lazarus config directory" msgstr "" #: lazarusidestrconsts:lismenufile msgid "&File" msgstr "&Soubor" #: lazarusidestrconsts:lismenuedit msgid "&Edit" msgstr "&Editace" #: lazarusidestrconsts:lismenusearch msgid "&Search" msgstr "&Hledat" #: lazarusidestrconsts:lismenuview msgid "&View" msgstr "&Zobrazení" #: lazarusidestrconsts:lismenuproject msgid "&Project" msgstr "&Projekt" #: lazarusidestrconsts:lismenurun msgid "&Run" msgstr "&Spustit" #: lazarusidestrconsts:lismenucomponents msgid "&Components" msgstr "&Komponenty" #: lazarusidestrconsts:lismenutools msgid "&Tools" msgstr "&Nástroje" #: lazarusidestrconsts:lismenuenvironent msgid "E&nvironment" msgstr "P&rostředí" #: lazarusidestrconsts:lismenuwindow msgid "&Window" msgstr "&Okno" #: lazarusidestrconsts:lismenuhelp msgid "&Help" msgstr "&Nápověda" #: lazarusidestrconsts:lismenunewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts:lismenunewform msgid "New Form" msgstr "Nový formulář" #: lazarusidestrconsts:lismenunewother msgid "New ..." msgstr "Nový ..." #: lazarusidestrconsts:lismenuopen msgid "Open ..." msgstr "" #: lazarusidestrconsts:lismenurevert msgid "Revert" msgstr "" #: lazarusidestrconsts:lispkgeditpublishpackage msgid "Publish Package" msgstr "" #: lazarusidestrconsts:lismenuopenrecent msgid "Open Recent ..." msgstr "" #: lazarusidestrconsts:lismenusave msgid "Save" msgstr "" #: lazarusidestrconsts:liskmsaveas msgid "SaveAs" msgstr "" #: lazarusidestrconsts:liskmsaveall msgid "SaveAll" msgstr "" #: lazarusidestrconsts:lisdiscardchanges msgid "Discard changes" msgstr "Zahodit změny" #: lazarusidestrconsts:lisdonotclosetheproject msgid "Do not close the project" msgstr "Nezavírat projekt" #: lazarusidestrconsts:lisdonotclosetheide msgid "Do not close the IDE" msgstr "Nezavírat IDE" #: lazarusidestrconsts:lismenusaveas msgid "Save As ..." msgstr "" #: lazarusidestrconsts:lismenusaveall msgid "Save All" msgstr "" #: lazarusidestrconsts:lismenuclose msgid "Close" msgstr "" #: lazarusidestrconsts:lispldonlyexistingfiles msgid "Only existing files" msgstr "" #: lazarusidestrconsts:lispldshowgloballinks msgid "Show global links" msgstr "" #: lazarusidestrconsts:lispldshowuserlinks msgid "Show user links" msgstr "" #: lazarusidestrconsts:liskmcloseall msgid "Close All" msgstr "" #: lazarusidestrconsts:lisctdefdefinetemplates msgid "Define templates" msgstr "" #: lazarusidestrconsts:lismenucloseall msgid "Close all editor files" msgstr "" #: lazarusidestrconsts:lismenucleandirectory msgid "Clean directory ..." msgstr "" #: lazarusidestrconsts:lismenuquit msgid "Quit" msgstr "Ukončit" #: lazarusidestrconsts:lismenurestart msgid "Restart" msgstr "" #: lazarusidestrconsts:lismenuundo msgid "Undo" msgstr "" #: lazarusidestrconsts:lismenuredo msgid "Redo" msgstr "" #: lazarusidestrconsts:lismenucut msgid "Cut" msgstr "" #: lazarusidestrconsts:lismenucopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:lismenupaste msgid "Paste" msgstr "" #: lazarusidestrconsts:lismenuindentselection msgid "Indent selection" msgstr "" #: lazarusidestrconsts:lismenuunindentselection msgid "Unindent selection" msgstr "" #: lazarusidestrconsts:lismenuuppercaseselection msgid "Uppercase selection" msgstr "Výběr velkých písmen" #: lazarusidestrconsts:lismenulowercaseselection msgid "Lowercase selection" msgstr "" #: lazarusidestrconsts:lismenutabstospacesselection msgid "Tabs to spaces in selection" msgstr "" #: lazarusidestrconsts:lismenuencloseselection msgid "Enclose selection ..." msgstr "" #: lazarusidestrconsts:lismenucommentselection msgid "Comment selection" msgstr "" #: lazarusidestrconsts:lismenuuncommentselection msgid "Uncomment selection" msgstr "" #: lazarusidestrconsts:liskminsertifdef msgid "Insert $IFDEF" msgstr "" #: lazarusidestrconsts:lismenuconditionalselection msgid "Insert $IFDEF..." msgstr "" #: lazarusidestrconsts:lismenusortselection msgid "Sort selection ..." msgstr "" #: lazarusidestrconsts:lismenubeaklinesinselection msgid "Break Lines in selection" msgstr "Ukončit žádky ve výběru" #: lazarusidestrconsts:liskmselectwordleft msgid "Select word left" msgstr "" #: lazarusidestrconsts:liskmselectwordright msgid "Select word right" msgstr "" #: lazarusidestrconsts:liskmselectlinestart msgid "Select line start" msgstr "" #: lazarusidestrconsts:liskmselectlineend msgid "Select line end" msgstr "" #: lazarusidestrconsts:liskmselectpagetop msgid "Select page top" msgstr "" #: lazarusidestrconsts:liskmselectpagebottom msgid "Select page bottom" msgstr "" #: lazarusidestrconsts:lismenuselect msgid "Select" msgstr "" #: lazarusidestrconsts:lismenuselectall msgid "Select all" msgstr "" #: lazarusidestrconsts:lismenuselecttobrace msgid "Select to brace" msgstr "" #: lazarusidestrconsts:lismenuselectcodeblock msgid "Select code block" msgstr "" #: lazarusidestrconsts:lismenuselectword msgid "Select word" msgstr "" #: lazarusidestrconsts:lismenuselectline msgid "Select line" msgstr "" #: lazarusidestrconsts:lismenuselectparagraph msgid "Select paragraph" msgstr "" #: lazarusidestrconsts:lismenuinsertcharacter msgid "Insert from Character Map" msgstr "" #: lazarusidestrconsts:lismenuinserttext msgid "Insert text" msgstr "" #: lazarusidestrconsts:lismenuinsertcvskeyword msgid "CVS keyword" msgstr "" #: lazarusidestrconsts:lismenuinsertgeneral msgid "General" msgstr "" #: lazarusidestrconsts:lisnone2 msgid "none" msgstr "" #: lazarusidestrconsts:lisor msgid "or" msgstr "" #: lazarusidestrconsts:lisnone msgid "%snone" msgstr "%sžádný" #: lazarusidestrconsts:lisunitpaths msgid "Unit paths" msgstr "" #: lazarusidestrconsts:lisincludepaths msgid "Include paths" msgstr "" #: lazarusidestrconsts:lissourcepaths msgid "Source paths" msgstr "" #: lazarusidestrconsts:lismenucompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts:lismenuextractproc msgid "Extract procedure ..." msgstr "" #: lazarusidestrconsts:lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "" #: lazarusidestrconsts:lismenurenameidentifier msgid "Rename Identifier ..." msgstr "" #: lazarusidestrconsts:lismenuinsertgplnotice msgid "GPL notice" msgstr "" #: lazarusidestrconsts:lismenuinsertlgplnotice msgid "LGPL notice" msgstr "" #: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" msgstr "Poznámka k upravené LGPL" #: lazarusidestrconsts:lismenuinsertusername msgid "Current username" msgstr "" #: lazarusidestrconsts:lismenuinsertdatetime msgid "Current date and time" msgstr "" #: lazarusidestrconsts:lismenuinsertchangelogentry msgid "ChangeLog entry" msgstr "" #: lazarusidestrconsts:lismenufind msgid "Find" msgstr "" #: lazarusidestrconsts:lismenufindnext msgid "Find &Next" msgstr "" #: lazarusidestrconsts:lismenufind2 msgid "Find ..." msgstr "" #: lazarusidestrconsts:lismenufindprevious msgid "Find &Previous" msgstr "" #: lazarusidestrconsts:lismenufindinfiles msgid "Find &in files ..." msgstr "" #: lazarusidestrconsts:lismenureplace msgid "Replace" msgstr "" #: lazarusidestrconsts:lismenuincrementalfind msgid "Incremental Find" msgstr "" #: lazarusidestrconsts:lismenureplace2 msgid "Replace ..." msgstr "" #: lazarusidestrconsts:lismenugotoline msgid "Goto line ..." msgstr "" #: lazarusidestrconsts:lismenujumpback msgid "Jump back" msgstr "" #: lazarusidestrconsts:lismenujumpforward msgid "Jump forward" msgstr "" #: lazarusidestrconsts:lismenuaddjumppointtohistory msgid "Add jump point to history" msgstr "Přidat bod skoku do historie" #: lazarusidestrconsts:lismenuviewjumphistory msgid "View Jump-History ..." msgstr "" #: lazarusidestrconsts:lismenufindblockotherendofcodeblock msgid "Find other end of code block" msgstr "" #: lazarusidestrconsts:lismenufindcodeblockstart msgid "Find code block start" msgstr "" #: lazarusidestrconsts:lismenufinddeclarationatcursor msgid "Find Declaration at cursor" msgstr "" #: lazarusidestrconsts:lismenuopenfilenameatcursor msgid "Open filename at cursor" msgstr "" #: lazarusidestrconsts:lismenugotoincludedirective msgid "Goto include directive" msgstr "" #: lazarusidestrconsts:lismenujumptonexterror msgid "Jump to next error" msgstr "" #: lazarusidestrconsts:lismenujumptopreverror msgid "Jump to previous error" msgstr "" #: lazarusidestrconsts:lismenusetfreebookmark msgid "Set a free bookmark" msgstr "" #: lazarusidestrconsts:lismenujumptonextbookmark msgid "Jump to next bookmark" msgstr "" #: lazarusidestrconsts:lismenujumptoprevbookmark msgid "Jump to previous bookmark" msgstr "" #: lazarusidestrconsts:lismenuviewobjectinspector msgid "Object Inspector" msgstr "" #: lazarusidestrconsts:lismenuviewsourceeditor msgid "Source Editor" msgstr "" #: lazarusidestrconsts:lismenuviewcodeexplorer msgid "Code Explorer" msgstr "" #: lazarusidestrconsts:lismenuviewcodebrowser msgid "Code Browser" msgstr "" #: lazarusidestrconsts:lismenujumpto msgid "Jump to" msgstr "" #: lazarusidestrconsts:lismenuviewunits msgid "Units..." msgstr "Jednotky..." #: lazarusidestrconsts:lismenuviewforms msgid "Forms..." msgstr "" #: lazarusidestrconsts:lismenuviewunitdependencies msgid "View Unit Dependencies" msgstr "" #: lazarusidestrconsts:liskmviewunitinfo msgid "View Unit Info" msgstr "" #: lazarusidestrconsts:lismenuviewunitinfo msgid "View Unit Information" msgstr "" #: lazarusidestrconsts:lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "" #: lazarusidestrconsts:lismenuviewmessages msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" msgstr "" #: lazarusidestrconsts:liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" msgstr "Zkopírovat všechny zprávy do schránky" #: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" msgstr "Zkopírovat všechny a skryté zprávy do schránky" #: lazarusidestrconsts:lissaveallmessagestofile msgid "Save all messages to file" msgstr "" #: lazarusidestrconsts:lismenuviewsearchresults msgid "Search Results" msgstr "" #: lazarusidestrconsts:lissearchagain msgid "Search again" msgstr "" #: lazarusidestrconsts:lissrclosepage msgid "Close page" msgstr "" #: lazarusidestrconsts:lismenuviewanchoreditor msgid "View Anchor Editor" msgstr "" #: lazarusidestrconsts:liskmtoggleviewcomponentpalette msgid "Toggle view component palette" msgstr "" #: lazarusidestrconsts:lismenuviewcomponentpalette msgid "View Component Palette" msgstr "" #: lazarusidestrconsts:lismenuviewidespeedbuttons msgid "View IDE speed buttons" msgstr "" #: lazarusidestrconsts:lismenudebugwindows msgid "Debug windows" msgstr "" #: lazarusidestrconsts:lismenuviewwatches msgid "Watches" msgstr "Sledování" #: lazarusidestrconsts:lismenuviewbreakpoints msgid "BreakPoints" msgstr "Body přerušení" #: lazarusidestrconsts:lismenuviewlocalvariables msgid "Local Variables" msgstr "" #: lazarusidestrconsts:lismenuviewcallstack msgid "Call Stack" msgstr "" #: lazarusidestrconsts:lismenuviewdebugoutput msgid "Debug output" msgstr "" #: lazarusidestrconsts:lismenuideinternals msgid "IDE internals" msgstr "" #: lazarusidestrconsts:lismenupackagelinks msgid "Package links ..." msgstr "" #: lazarusidestrconsts:lismenunewproject msgid "New Project ..." msgstr "Nový projekt ..." #: lazarusidestrconsts:lismenunewprojectfromfile msgid "New Project from file ..." msgstr "Nový projekt ze souboru ..." #: lazarusidestrconsts:lismenuopenproject msgid "Open Project ..." msgstr "" #: lazarusidestrconsts:lismenucloseproject msgid "Close Project" msgstr "" #: lazarusidestrconsts:lismenuopenrecentproject msgid "Open Recent Project ..." msgstr "" #: lazarusidestrconsts:lismenusaveproject msgid "Save Project" msgstr "" #: lazarusidestrconsts:lismenusaveprojectas msgid "Save Project As ..." msgstr "" #: lazarusidestrconsts:lismenupublishproject msgid "Publish Project ..." msgstr "" #: lazarusidestrconsts:lismenuprojectinspector msgid "Project Inspector" msgstr "" #: lazarusidestrconsts:liskmaddactiveunittoproject msgid "Add active unit to project" msgstr "Přidat aktivní jednotku do projektu" #: lazarusidestrconsts:liskmremoveactiveunitfromproject msgid "Remove active unit from project" msgstr "" #: lazarusidestrconsts:liskmviewprojectsource msgid "View project source" msgstr "" #: lazarusidestrconsts:liskmviewprojecttodolist msgid "View project ToDo list" msgstr "" #: lazarusidestrconsts:lismenuaddtoproject msgid "Add editor file to Project" msgstr "Přidat editovaný soubor do projektu" #: lazarusidestrconsts:lismenuremovefromproject msgid "Remove from Project ..." msgstr "" #: lazarusidestrconsts:lismenuviewsource msgid "View Source" msgstr "" #: lazarusidestrconsts:lismenuviewprojecttodos msgid "View ToDo List ..." msgstr "" #: lazarusidestrconsts:lismenuprojectoptions msgid "Project Options ..." msgstr "Volby projektu ..." #: lazarusidestrconsts:lismenubuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts:lisbfbuildcommand msgid "Build Command" msgstr "Sestavit povel" #: lazarusidestrconsts:lismenubuildall msgid "Build all" msgstr "Sestavit vše" #: lazarusidestrconsts:lismenuquickcompile msgid "Quick compile" msgstr "" #: lazarusidestrconsts:lismenuabortbuild msgid "Abort Build" msgstr "Přerušit sestavení" #: lazarusidestrconsts:lismenuprojectrun msgid "Run" msgstr "" #: lazarusidestrconsts:lisbfalwaysbuildbeforerun msgid "Always Build before Run" msgstr "Vždy sestavit před spuštěním" #: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2 msgid "Working Directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts:lisbfruncommand msgid "Run Command" msgstr "" #: lazarusidestrconsts:lismenupause msgid "Pause" msgstr "" #: lazarusidestrconsts:lismenustepinto msgid "Step into" msgstr "" #: lazarusidestrconsts:lismenustepover msgid "Step over" msgstr "" #: lazarusidestrconsts:lismenuruntocursor msgid "Run to cursor" msgstr "" #: lazarusidestrconsts:liskmstopprogram msgid "Stop program" msgstr "" #: lazarusidestrconsts:lismenustop msgid "Stop" msgstr "" #: lazarusidestrconsts:liscontinue msgid "Continue" msgstr "" #: lazarusidestrconsts:lismenuresetdebugger msgid "Reset debugger" msgstr "" #: lazarusidestrconsts:liskmcompileroptions msgid "Compiler options" msgstr "Volby překladače" #: lazarusidestrconsts:lismenucompileroptions msgid "Compiler Options ..." msgstr "Volby překladače ..." #: lazarusidestrconsts:lismenurunparameters msgid "Run Parameters ..." msgstr "" #: lazarusidestrconsts:lismenubuildfile msgid "Build File" msgstr "Sestavit soubor" #: lazarusidestrconsts:lismenurunfile msgid "Run File" msgstr "" #: lazarusidestrconsts:liskmconfigbuildfile msgid "Config %sBuild File%s" msgstr "Konfigurace %sSoubor sestavení %s" #: lazarusidestrconsts:liskminspect msgid "Inspect" msgstr "" #: lazarusidestrconsts:liskmevaluatemodify msgid "Evaluate/Modify" msgstr "" #: lazarusidestrconsts:liskmaddwatch msgid "Add watch" msgstr "Přidat sledování" #: lazarusidestrconsts:lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "" #: lazarusidestrconsts:lismenuinspect msgid "Inspect ..." msgstr "" #: lazarusidestrconsts:lismenuevaluate msgid "Evaluate/Modify ..." msgstr "" #: lazarusidestrconsts:lismenuaddwatch msgid "Add watch ..." msgstr "Přidat sledování ..." #: lazarusidestrconsts:lismenuaddbreakpoint msgid "Add breakpoint" msgstr "Přidat bod přerušení" #: lazarusidestrconsts:lismenuaddbpsource msgid "Source breakpoint" msgstr "" #: lazarusidestrconsts:lismenuopenpackage msgid "Open loaded package ..." msgstr "" #: lazarusidestrconsts:lismenuopenrecentpkg msgid "Open recent package ..." msgstr "" #: lazarusidestrconsts:lismenuopenpackagefile msgid "Open package file (.lpk) ..." msgstr "" #: lazarusidestrconsts:lismenuopenpackageofcurunit msgid "Open package of current unit" msgstr "" #: lazarusidestrconsts:lismenuaddcurunittopkg msgid "Add active unit to a package" msgstr "Přidat aktivní jednotku do balíčku" #: lazarusidestrconsts:liskmpackagegraph msgid "Package graph" msgstr "" #: lazarusidestrconsts:liskmconfigureinstalledpackages msgid "Configure installed packages" msgstr "" #: lazarusidestrconsts:liskmconfigurecustomcomponents msgid "Configure custom components" msgstr "" #: lazarusidestrconsts:lismenupackagegraph msgid "Package Graph ..." msgstr "" #: lazarusidestrconsts:lismenueditinstallpkgs msgid "Configure installed packages ..." msgstr "" #: lazarusidestrconsts:lismenuconfigcustomcomps msgid "Configure custom components ..." msgstr "" #: lazarusidestrconsts:lismenusettings msgid "Configure custom tools ..." msgstr "" #: lazarusidestrconsts:lismenuquicksyntaxcheck msgid "Quick syntax check" msgstr "" #: lazarusidestrconsts:lismenuguessunclosedblock msgid "Guess unclosed block" msgstr "" #: lazarusidestrconsts:lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" msgstr "" #: lazarusidestrconsts:lismenumakeresourcestring msgid "Make Resource String ..." msgstr "" #: lazarusidestrconsts:lismenudiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts:lismenuconvertdfmtolfm msgid "Convert DFM file to LFM ..." msgstr "Převést DFM soubor na LFM ..." #: lazarusidestrconsts:lismenuchecklfm msgid "Check LFM file in editor" msgstr "" #: lazarusidestrconsts:lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Převést Delphi jednotku na Lazarus jednotku ..." #: lazarusidestrconsts:lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." msgstr "Převést Delphi projekt na Lazarus projekt ..." #: lazarusidestrconsts:lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." msgstr "Převést Delphi balíček na Lazarus balíček ..." #: lazarusidestrconsts:lismenubuildlazarus msgid "Build Lazarus" msgstr "Sestavit Lazarus" #: lazarusidestrconsts:lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Nastavení \"Sestavení Lazarusu\" ..." #: lazarusidestrconsts:lismenugeneraloptions msgid "Environment options ..." msgstr "" #: lazarusidestrconsts:lismenueditoroptions msgid "Editor options ..." msgstr "Nastavení editoru ..." #: lazarusidestrconsts:lismenueditcodetemplates msgid "Code Templates ..." msgstr "" #: lazarusidestrconsts:lismendebuggeroptions msgid "Debugger Options ..." msgstr "" #: lazarusidestrconsts:lismenucodetoolsoptions msgid "CodeTools Options ..." msgstr "" #: lazarusidestrconsts:lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." msgstr "" #: lazarusidestrconsts:lismenuonlinehelp msgid "Online Help" msgstr "" #: lazarusidestrconsts:lismenureportingbug msgid "Reporting a bug..." msgstr "" #: lazarusidestrconsts:lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts:liskmconfigurehelp msgid "Configure Help" msgstr "" #: lazarusidestrconsts:liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "" #: lazarusidestrconsts:liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts:lismenuconfigurehelp msgid "Configure Help ..." msgstr "" #: lazarusidestrconsts:lismenucontexthelp msgid "Context sensitive Help" msgstr "" #: lazarusidestrconsts:lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts:lismenucreatelazdocfiles msgid "Create LazDoc files" msgstr "" #: lazarusidestrconsts:lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "" #: lazarusidestrconsts:lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "" #: lazarusidestrconsts:lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "" #: lazarusidestrconsts:lisdsgselectparentcomponent msgid "Select parent component" msgstr "" #: lazarusidestrconsts:lisdsgordermovetofront msgid "Move component to front" msgstr "" #: lazarusidestrconsts:lisdsgordermovetoback msgid "Move component to back" msgstr "" #: lazarusidestrconsts:lisdsgorderforwardone msgid "Move component one forward" msgstr "" #: lazarusidestrconsts:lisdsgorderbackone msgid "Move component one back" msgstr "" #: lazarusidestrconsts:lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "" #: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "" #: lazarusidestrconsts:liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "Volby překladače pro projekt %s" #: lazarusidestrconsts:lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "" #: lazarusidestrconsts:lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "" #: lazarusidestrconsts:lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "" #: lazarusidestrconsts:lisdelphiproject msgid "Delphi project" msgstr "Projekt Delphi" #: lazarusidestrconsts:lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" msgstr "" #: lazarusidestrconsts:lisformaterror msgid "Format error" msgstr "" #: lazarusidestrconsts:lislfmfilecorrupt msgid "LFM file corrupt" msgstr "" #: lazarusidestrconsts:lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" msgstr "" #: lazarusidestrconsts:lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" msgstr "" #: lazarusidestrconsts:liserrorcreatinglrs msgid "Error creating lrs" msgstr "" #: lazarusidestrconsts:lislfmfilenotfound msgid "LFM file not found" msgstr "" #: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." msgstr "" #: lazarusidestrconsts:lisunitnotfound msgid "Unit not found" msgstr "" #: lazarusidestrconsts:lisunitsnotfound2 msgid "Units not found" msgstr "Jednotka nenalezena" #: lazarusidestrconsts:lisunitlfmfile msgid "Unit: %s%sLFM file: %s" msgstr "Jednotka: %s%ssoubor LFM: %s" #: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." msgstr "" #: lazarusidestrconsts:lisnotadelphiproject msgid "Not a Delphi project" msgstr "" #: lazarusidestrconsts:listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" msgstr "Soubor %s%s%s není Delphi projekt." #: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." msgstr "Nelze načíst starý soubor zdrojů.%sSoubor zdrojů je první vkládaný soubor v inicializační části %s.Na příklad {$I %s.lrs}.%sPravděpodobně chyba syntaxe." #: lazarusidestrconsts:lisresourceloaderror msgid "Resource load error" msgstr "" #: lazarusidestrconsts:lisignoremissingfile msgid "Ignore missing file" msgstr "" #: lazarusidestrconsts:lisnoname msgid "noname" msgstr "" #: lazarusidestrconsts:listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." msgstr "" #: lazarusidestrconsts:lisrenamefile msgid "Rename file?" msgstr "" #: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "" #: lazarusidestrconsts:lisrenametolowercase msgid "Rename to lowercase" msgstr "" #: lazarusidestrconsts:liskeepname msgid "Keep name" msgstr "" #: lazarusidestrconsts:lisoverwritefile msgid "Overwrite file?" msgstr "" #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Soubor %s%s%s už existuje.%sNahradit?" #: lazarusidestrconsts:lisoverwritefileondisk msgid "Overwrite file on disk" msgstr "" #: lazarusidestrconsts:lisambiguousfilesfound msgid "Ambiguous files found" msgstr "Nejednoznačné soubory nalezeny" #: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "" #: lazarusidestrconsts:lisdeleteoldfile msgid "Delete old file %s%s%s?" msgstr "Odstranit starý soubor %s%s%s?" #: lazarusidestrconsts:lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." msgstr "Odstranění souboru %s%s%s selhalo." #: lazarusidestrconsts:lisstreamingerror msgid "Streaming error" msgstr "" #: lazarusidestrconsts:lisunabletostreamt msgid "Unable to stream %s:T%s." msgstr "" #: lazarusidestrconsts:lisresourcesaveerror msgid "Resource save error" msgstr "" #: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts:lisunabletocreatefile2 msgid "Unable to create file %s%s%s" msgstr "" #: lazarusidestrconsts:liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "" #: lazarusidestrconsts:liscancelloadingunit msgid "Cancel loading unit" msgstr "" #: lazarusidestrconsts:lisabortallloading msgid "Abort all loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "" #: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "" #: lazarusidestrconsts:lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "" #: lazarusidestrconsts:lisabortloadingproject msgid "Abort loading project" msgstr "Přerušit načítání projektu" #: lazarusidestrconsts:lisfilenotfound2 msgid "File %s%s%s not found.%s" msgstr "" #: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" msgstr "" #: lazarusidestrconsts:lisprojectinfofiledetected msgid "Project info file detected" msgstr "" #: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." msgstr "Soubor %s vypadá, že je programový soubor existujícícho projektu Lazarusu." #: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "" #: lazarusidestrconsts:lisprogramdetected msgid "Program detected" msgstr "" #: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgstr "" #: lazarusidestrconsts:lisformloaderror msgid "Form load error" msgstr "" #: lazarusidestrconsts:lissaveprojectlpi msgid "Save Project %s (*.lpi)" msgstr "" #: lazarusidestrconsts:lisinvalidprojectfilename msgid "Invalid project filename" msgstr "" #: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s je chybné jméno projektu.%sProsím vyberte jiné (např. project1.lpi)" #: lazarusidestrconsts:listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lischooseadifferentname msgid "Choose a different name" msgstr "" #: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" msgstr "" #: lazarusidestrconsts:lisunitidentifierexists msgid "Unit identifier exists" msgstr "" #: lazarusidestrconsts:listhereisaunitwiththenameintheprojectplzchoose msgid "There is a unit with the name %s%s%s in the project.%sPlz choose a different name" msgstr "" #: lazarusidestrconsts:liserrorcreatingfile msgid "Error creating file" msgstr "" #: lazarusidestrconsts:lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscopyerror2 msgid "Copy error" msgstr "Chyba kopírování" #: lazarusidestrconsts:lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." msgstr "" #: lazarusidestrconsts:lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" msgstr "" #: lazarusidestrconsts:lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "" #: lazarusidestrconsts:lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts:lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts:lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts:lissourcemodified msgid "Source modified" msgstr "" #: lazarusidestrconsts:lisopenproject msgid "Open Project?" msgstr "" #: lazarusidestrconsts:lisopentheproject msgid "Open the project %s?" msgstr "" #: lazarusidestrconsts:lisopenpackage msgid "Open Package?" msgstr "" #: lazarusidestrconsts:lisopenthepackage msgid "Open the package %s?" msgstr "" #: lazarusidestrconsts:lisrevertfailed msgid "Revert failed" msgstr "" #: lazarusidestrconsts:lisfileisvirtual msgid "File %s%s%s is virtual." msgstr "" #: lazarusidestrconsts:lisunabletowrite msgid "Unable to write %s%s%s%s%s." msgstr "" #: lazarusidestrconsts:lisfilenottext msgid "File not text" msgstr "" #: lazarusidestrconsts:lisunabletorenamefile msgid "Unable to rename file" msgstr "" #: lazarusidestrconsts:lisunabletocopyfile msgid "Unable to copy file" msgstr "" #: lazarusidestrconsts:lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "" #: lazarusidestrconsts:lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "" #: lazarusidestrconsts:lisinvalidcommand msgid "Invalid command" msgstr "" #: lazarusidestrconsts:listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." msgstr "" #: lazarusidestrconsts:lisinvaliddestinationdirectory msgid "Invalid destination directory" msgstr "" #: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "Cílová složka %s%s%s je neplatná.%sProsím vyberte a celou cestu." #: lazarusidestrconsts:lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "" #: lazarusidestrconsts:liscommandafterinvalid msgid "Command after invalid" msgstr "" #: lazarusidestrconsts:listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgstr "" #: lazarusidestrconsts:liscommandafterpublishingmodule msgid "Command after publishing module" msgstr "" #: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "" #: lazarusidestrconsts:lisaddtoproject msgid "Add %s to project?" msgstr "Přidat %s do projektu?" #: lazarusidestrconsts:listhefile msgid "The file %s%s%s" msgstr "Soubor %s%s%s" #: lazarusidestrconsts:lisisalreadypartoftheproject msgid "%s is already part of the Project." msgstr "%s už je částí projektu." #: lazarusidestrconsts:lisremovefromproject msgid "Remove from project" msgstr "" #: lazarusidestrconsts:liscreateaprojectfirst msgid "Create a project first!" msgstr "" #: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" msgstr "" #: lazarusidestrconsts:lisbuildnewproject msgid "Build new project" msgstr "Sestavit nový projekt" #: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgstr "" #: lazarusidestrconsts:lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built. :)" msgstr "" #: lazarusidestrconsts:lisexecutingcommandbefore msgid "Executing command before" msgstr "" #: lazarusidestrconsts:lisexecutingcommandafter msgid "Executing command after" msgstr "" #: lazarusidestrconsts:lisnoprogramfilesfound msgid "No program file %s%s%s found." msgstr "" #: lazarusidestrconsts:liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" msgstr "" #: lazarusidestrconsts:lisnotnow msgid "Not now" msgstr "" #: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." msgstr "Nemůžete sestavit lazarus v průběhu ladění nebo překládání." #: lazarusidestrconsts:lisunabletosavefile msgid "Unable to save file %s%s%s" msgstr "" #: lazarusidestrconsts:lisreaderror msgid "Read Error" msgstr "" #: lazarusidestrconsts:lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" msgstr "" #: lazarusidestrconsts:liswriteerror msgid "Write Error" msgstr "Chyba zápisu" #: lazarusidestrconsts:lisunabletowritetofile msgid "Unable to write to file %s%s%s!" msgstr "" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2 msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "" #: lazarusidestrconsts:lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." msgstr "" #: lazarusidestrconsts:lisambiguousunitfound2 msgid "Ambiguous unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" msgstr "" #: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "" #: lazarusidestrconsts:lisignoreall msgid "Ignore all" msgstr "" #: lazarusidestrconsts:lisdeletefilefailed msgid "Delete file failed" msgstr "Odstranění souboru selhalo" #: lazarusidestrconsts:lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" msgstr "" #: lazarusidestrconsts:lisrenamefilefailed msgid "Rename file failed" msgstr "" #: lazarusidestrconsts:lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts:lisbackupfilefailed msgid "Backup file failed" msgstr "Záožní soubor selhal" #: lazarusidestrconsts:lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts:lisfilenotlowercase msgid "File not lowercase" msgstr "" #: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" msgstr "" #: lazarusidestrconsts:lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "Odstranit nejednoznačný soubor?" #: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgstr "Nalezen nejednoznačný soubor: %s%s%s%sTento soubor může být chybě zaměněn za %s%s%s%s%sSmazat nejednoznačný soubor?" #: lazarusidestrconsts:lislazaruseditorv msgid "Lazarus Editor v%s" msgstr "" #: lazarusidestrconsts:lisnewproject msgid "%s - (new project)" msgstr "%s - (nový projekt)" #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" msgstr "%s (kompilování ...)" #: lazarusidestrconsts:lisdebugging msgid "%s (debugging ...)" msgstr "%s (ladění ...)" #: lazarusidestrconsts:lisunabletofindfile msgid "Unable to find file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sCheck search path in%sProject->Compiler Options...->Search Paths->Other Unit Files" msgstr "" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "" #: lazarusidestrconsts:lisclassnotfound msgid "Class not found" msgstr "" #: lazarusidestrconsts:lisoifclassnotfound msgid "Class %s%s%s not found." msgstr "" #: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgstr "" #: lazarusidestrconsts:liscontrolneedsparent msgid "Control needs parent" msgstr "" #: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." msgstr "" #: lazarusidestrconsts:lisconversionerror msgid "Conversion error" msgstr "" #: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "" #: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "" #: lazarusidestrconsts:lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "" #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." msgstr "" #: lazarusidestrconsts:lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "" #: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts:liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" msgstr "Jméno komponenty není platný identifikátor" #: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgstr "Zdvojené jméno: Komponenta pojmenovaná %s%s%s již existuje ve zděděné komponentě %s" #: lazarusidestrconsts:liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" msgstr "Jméno komponenty je klíčové slovo" #: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts:lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "" #: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "" #: lazarusidestrconsts:listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" msgstr "" #: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts:lisseemessages msgid "See messages." msgstr "" #: lazarusidestrconsts:liserror msgid "Error: " msgstr "" #: lazarusidestrconsts:lissavechanges msgid "Save changes?" msgstr "" #: lazarusidestrconsts:lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgstr "" #: lazarusidestrconsts:lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "" #: lazarusidestrconsts:lissorrynotimplementedyet msgid "Sorry, not implemented yet" msgstr "" #: lazarusidestrconsts:lisunabletofindmethodplzfixtheerrorshowninthemessage msgid "Unable to find method. Plz fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisunabletocreatenewmethodplzfixtheerrorshownin msgid "Unable to create new method. Plz fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisunabletoshowmethodplzfixtheerrorshowninthemessage msgid "Unable to show method. Plz fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisunabletorenamemethodplzfixtheerrorshowninthemessag msgid "Unable to rename method. Plz fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisstopdebugging msgid "Stop Debugging?" msgstr "" #: lazarusidestrconsts:lisstopthedebugging msgid "Stop the debugging?" msgstr "" #: lazarusidestrconsts:liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" msgstr "" #: lazarusidestrconsts:lisresourcefilecomment msgid "This is an automatically generated lazarus resource file" msgstr "" #: lazarusidestrconsts:lisopenfile msgid "Open file" msgstr "" #: lazarusidestrconsts:lisiecoexportfileexists msgid "Export file exists" msgstr "" #: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts:lisiecoopenorloadcompileroptions msgid "Open or Load Compiler Options" msgstr "" #: lazarusidestrconsts:lisiecoerroraccessingxml msgid "Error accessing xml" msgstr "" #: lazarusidestrconsts:lisiecoerrorloadingxml msgid "Error loading xml" msgstr "" #: lazarusidestrconsts:lisiecoerrorloadingxmlfile msgid "Error loading xml file %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts:lisiecoerroraccessingxmlfile msgid "Error accessing xml file %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts:lisiecorecentfiles msgid "Recent files" msgstr "" #: lazarusidestrconsts:lisiecosavetorecent msgid "Save to recent" msgstr "" #: lazarusidestrconsts:lisiecoopenrecent msgid "Open recent" msgstr "" #: lazarusidestrconsts:lisiecosavetofile msgid "Save to file" msgstr "" #: lazarusidestrconsts:lisiecoloadfromfile msgid "Load from file" msgstr "" #: lazarusidestrconsts:lislazarusfile msgid "Lazarus File" msgstr "" #: lazarusidestrconsts:lispascalunit msgid "Pascal unit" msgstr "" #: lazarusidestrconsts:lispascalsourcefile msgid "Pascal source file" msgstr "" #: lazarusidestrconsts:lisfreepascalsourcefile msgid "FreePascal source file" msgstr "" #: lazarusidestrconsts:lisdebugunabletoloadfile msgid "Unable to load file" msgstr "Nelze načíst soubor" #: lazarusidestrconsts:lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." msgstr "Nelze načíst soubor %s%s%s." #: lazarusidestrconsts:lisopenprojectfile msgid "Open Project File" msgstr "" #: lazarusidestrconsts:lislazarusprojectinfofile msgid "Lazarus Project Info file" msgstr "" #: lazarusidestrconsts:lisallfiles msgid "All Files" msgstr "Všechny soubory" #: lazarusidestrconsts:lisprojectclosed msgid "Project closed" msgstr "Projekt zavřen" #: lazarusidestrconsts:listheprojectisclosedtherearenowthreepossibilitieshin msgid "The project is closed. There are now three possibilities.%sHint: You do not need to close a project yourself, since this is done automatically." msgstr "" #: lazarusidestrconsts:lisquitlazarus msgid "Quit Lazarus" msgstr "Ukončit Lazarus" #: lazarusidestrconsts:liscreatenewproject msgid "Create new project" msgstr "" #: lazarusidestrconsts:lisopenpackagefile msgid "Open Package File" msgstr "" #: lazarusidestrconsts:lissavespace msgid "Save " msgstr "" #: lazarusidestrconsts:lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "" #: lazarusidestrconsts:lischoosedirectory msgid "Choose directory" msgstr "" #: lazarusidestrconsts:lisdestinationdirectory msgid "Destination directory" msgstr "Cílová složka" #: lazarusidestrconsts:liscommandafter msgid "Command after" msgstr "" #: lazarusidestrconsts:lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "" #: lazarusidestrconsts:lischoosecompilerpath msgid "Choose compiler filename (%s)" msgstr "" #: lazarusidestrconsts:lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "" #: lazarusidestrconsts:lischoosemakepath msgid "Choose make path" msgstr "" #: lazarusidestrconsts:lischoosedebuggerpath msgid "Choose debugger filename" msgstr "" #: lazarusidestrconsts:lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "" #: lazarusidestrconsts:lislazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "" #: lazarusidestrconsts:lisxmlfiles msgid "XML files" msgstr "XML soubory" #: lazarusidestrconsts:lissavechangestoproject msgid "Save changes to project %s?" msgstr "" #: lazarusidestrconsts:lisprojectchanged msgid "Project changed" msgstr "Projekt změněn" #: lazarusidestrconsts:lisfpcsourcedirectoryerror msgid "FPC Source Directory error" msgstr "" #: lazarusidestrconsts:lisplzcheckthefpcsourcedirectory msgid "Please check the freepascal source directory" msgstr "" #: lazarusidestrconsts:liscompilererror msgid "Compiler error" msgstr "Chyba překladače" #: lazarusidestrconsts:lisplzcheckthecompilername msgid "Please check the compiler name" msgstr "" #: lazarusidestrconsts:lisaboutlazarus msgid "About Lazarus" msgstr "O Lazarusu" #: lazarusidestrconsts:lisversion msgid "Version" msgstr "Verze" #: lazarusidestrconsts:lisdate msgid "Date" msgstr "" #: lazarusidestrconsts:lissvnrevision msgid "SVN Revision: " msgstr "" #: lazarusidestrconsts:lisclose msgid "&Close" msgstr "&Zavřít" #: lazarusidestrconsts:lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." msgstr "" #: lazarusidestrconsts:lisaboutnocontributors msgid "Cannot find contributors list." msgstr "" #: lazarusidestrconsts:lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "Jméno jednotky je už v projektu" #: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "" #: lazarusidestrconsts:lisforcerenaming msgid "Force renaming" msgstr "" #: lazarusidestrconsts:liscancelrenaming msgid "Cancel renaming" msgstr "" #: lazarusidestrconsts:lisabortall msgid "Abort all" msgstr "Přerušit vše" #: lazarusidestrconsts:lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "" #: lazarusidestrconsts:lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:liscopyerror msgid "Copy Error" msgstr "Chyba kopírování" #: lazarusidestrconsts:lishintopen msgid "Open" msgstr "" #: lazarusidestrconsts:lishintsave msgid "Save" msgstr "" #: lazarusidestrconsts:lishintsaveall msgid "Save all" msgstr "" #: lazarusidestrconsts:lishinttoggleformunit msgid "Toggle Form/Unit" msgstr "" #: lazarusidestrconsts:lishintviewunits msgid "View Units" msgstr "" #: lazarusidestrconsts:lishintviewforms msgid "View Forms" msgstr "" #: lazarusidestrconsts:lishintrun msgid "Run" msgstr "" #: lazarusidestrconsts:lishintpause msgid "Pause" msgstr "" #: lazarusidestrconsts:lishintstepinto msgid "Step Into" msgstr "" #: lazarusidestrconsts:lishintstepover msgid "Step Over" msgstr "" #: lazarusidestrconsts:lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(podadresáře ne)" #: lazarusidestrconsts:dlgsearchcaption msgid "Searching..." msgstr "" #: lazarusidestrconsts:dlgsearchabort msgid "Search terminated by user." msgstr "" #: lazarusidestrconsts:lissmatches msgid "Matches" msgstr "" #: lazarusidestrconsts:lisssearching msgid "Searching" msgstr "" #: lazarusidestrconsts:lisssearchtext msgid "Search text" msgstr "" #: lazarusidestrconsts:dlgdesktop msgid "Desktop" msgstr "Plocha" #: lazarusidestrconsts:dlgwindows msgid "Windows" msgstr "Okna" #: lazarusidestrconsts:dlgfrmeditor msgid "Form Editor" msgstr "" #: lazarusidestrconsts:dlgobjinsp msgid "Object Inspector" msgstr "" #: lazarusidestrconsts:dlgenvfiles msgid "Files" msgstr "" #: lazarusidestrconsts:lisignorebinaries msgid "Ignore binaries" msgstr "" #: lazarusidestrconsts:lissimplesyntax msgid "Simple Syntax" msgstr "" #: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "" #: lazarusidestrconsts:lisuseexcludefilter msgid "Use Exclude Filter" msgstr "" #: lazarusidestrconsts:lisexcludefilter msgid "Exclude Filter" msgstr "" #: lazarusidestrconsts:lisprojectinformation msgid "Project Information" msgstr "" #: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" msgstr "" #: lazarusidestrconsts:lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" msgstr "" #: lazarusidestrconsts:lisuseincludefilter msgid "Use Include Filter" msgstr "" #: lazarusidestrconsts:lisincludefilter msgid "Include Filter" msgstr "" #: lazarusidestrconsts:dlgenvbckup msgid "Backup" msgstr "Záloha" #: lazarusidestrconsts:dlgnaming msgid "Naming" msgstr "Pojmenování" #: lazarusidestrconsts:lislazdoc msgid "LazDoc" msgstr "" #: lazarusidestrconsts:lisokbtn msgid "Ok" msgstr "" #: lazarusidestrconsts:dlgcancel msgid "Cancel" msgstr "" #: lazarusidestrconsts:liskmclassic msgid "Classic" msgstr "" #: lazarusidestrconsts:liskmmacosx msgid "Mac OS X" msgstr "" #: lazarusidestrconsts:lispefilename msgid "Filename:" msgstr "" #: lazarusidestrconsts:lispeunitname msgid "Unitname:" msgstr "Jméno jednotky:" #: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts:lispetheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts:lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "" #: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lispeapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lispeinvalidunitname msgid "Invalid unitname" msgstr "" #: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts:lispetheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lispeconflictfound msgid "Conflict found" msgstr "" #: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts:lispethereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts:lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts:lisok msgid "&Ok" msgstr "&Ok" #: lazarusidestrconsts:liscmparameter msgid "Parameter" msgstr "" #: lazarusidestrconsts:lisctpleaseselectamacro msgid "please select a macro" msgstr "" #: lazarusidestrconsts:lisa2pcreatenewfile msgid "Create new file" msgstr "" #: lazarusidestrconsts:dlgenvlanguage msgid "Language" msgstr "" #: lazarusidestrconsts:dlgautosave msgid "Auto save" msgstr "Automaticky ukládat" #: lazarusidestrconsts:dlgedfiles msgid "Editor files" msgstr "Soubory editoru" #: lazarusidestrconsts:dlgenvproject msgid "Project" msgstr "Projekt" #: lazarusidestrconsts:liscodebrowser msgid "Code browser" msgstr "" #: lazarusidestrconsts:dlgintvinsec msgid "Interval in secs" msgstr "" #: lazarusidestrconsts:dlgdesktopfiles msgid "Desktop files" msgstr "Soubory na ploše" #: lazarusidestrconsts:dlgsavedfile msgid "Save desktop settings to file" msgstr "" #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "" #: lazarusidestrconsts:dlgminimizeallonminimizemain msgid "Minimize all on minimize main" msgstr "Minimalizovat všechno při minimalizování hlavního" #: lazarusidestrconsts:dlghideideonrun msgid "Hide IDE windows on run" msgstr "" #: lazarusidestrconsts:dlgpalhints msgid "Hints for component palette" msgstr "" #: lazarusidestrconsts:lischeckchangesondiskwithloading msgid "Check changes on disk with loading" msgstr "" #: lazarusidestrconsts:dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "" #: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" msgstr "Dvojklikna zprávu skočí na umístění (jinak: jeden klik)" #: lazarusidestrconsts:dlgwinpos msgid "Window Positions" msgstr "Poloha okna" #: lazarusidestrconsts:dlgmainmenu msgid "Main Menu" msgstr "" #: lazarusidestrconsts:dlgsrcedit msgid "Source Editor" msgstr "" #: lazarusidestrconsts:dlgmsgs msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:dlgprojfiles msgid "Project files" msgstr "Soubory projektu" #: lazarusidestrconsts:dlgenvtype msgid "Type" msgstr "" #: lazarusidestrconsts:dlgenvnone msgid "None" msgstr "" #: lazarusidestrconsts:dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "" #: lazarusidestrconsts:lisnobackupfiles msgid "No backup files" msgstr "Nezálohovat soubory" #: lazarusidestrconsts:dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "" #: lazarusidestrconsts:dlgsmbcounter msgid "Counter (.pp;1)" msgstr "" #: lazarusidestrconsts:dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Uživatelsky definované rozšíření (.pp.xxx)" #: lazarusidestrconsts:dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "" #: lazarusidestrconsts:dlgedcustomext msgid "User defined extension" msgstr "Uživatelsky definované rozšíření" #: lazarusidestrconsts:dlgmaxcntr msgid "Maximum counter" msgstr "" #: lazarusidestrconsts:dlgedbsubdir msgid "Sub directory" msgstr "" #: lazarusidestrconsts:dlgenvotherfiles msgid "Other files" msgstr "" #: lazarusidestrconsts:dlgmaxrecentfiles msgid "Max recent files" msgstr "" #: lazarusidestrconsts:dlgmaxrecentprojs msgid "Max recent project files" msgstr "" #: lazarusidestrconsts:dlgqopenlastprj msgid "Open last project at start" msgstr "" #: lazarusidestrconsts:dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "" #: lazarusidestrconsts:dlgfpcpath msgid "Compiler path (e.g. %s)" msgstr "Cesta překladače (např. %s)" #: lazarusidestrconsts:dlgfpcsrcpath msgid "FPC source directory" msgstr "" #: lazarusidestrconsts:dlgmakepath msgid "Make path" msgstr "" #: lazarusidestrconsts:dlgdebugtype msgid "Debugger type and path" msgstr "" #: lazarusidestrconsts:dlgtestprjdir msgid "Directory for building test projects" msgstr "Složka pro sestavení pokusných projektů" #: lazarusidestrconsts:dlgqshowgrid msgid "Show grid" msgstr "" #: lazarusidestrconsts:dlgqshowborderspacing msgid "Show border spacing" msgstr "" #: lazarusidestrconsts:dlggridcolor msgid "Grid color" msgstr "" #: lazarusidestrconsts:dlgqsnaptogrid msgid "Snap to grid" msgstr "" #: lazarusidestrconsts:dlggridx msgid "Grid size X" msgstr "" #: lazarusidestrconsts:dlggridxhint msgid "Horizontal grid step size" msgstr "" #: lazarusidestrconsts:dlggridy msgid "Grid size Y" msgstr "" #: lazarusidestrconsts:dlggridyhint msgid "Vertical grid step size" msgstr "Velikost kroku svislé mřížky" #: lazarusidestrconsts:dlgguidelines msgid "Show Guide Lines" msgstr "" #: lazarusidestrconsts:dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "" #: lazarusidestrconsts:dlglefttopclr msgid "color for left, top" msgstr "" #: lazarusidestrconsts:dlgrightbottomclr msgid "color for right, bottom" msgstr "" #: lazarusidestrconsts:dlgshowcaps msgid "Show component captions" msgstr "" #: lazarusidestrconsts:dlgshowedrhints msgid "Show editor hints" msgstr "" #: lazarusidestrconsts:dlgautoform msgid "Auto create form when opening unit" msgstr "Automaticky vytvořit formulář při otevření jednotky" #: lazarusidestrconsts:dlgrightclickselects msgid "Right Click selects" msgstr "" #: lazarusidestrconsts:dlggrabbercolor msgid "Grabber color" msgstr "" #: lazarusidestrconsts:dlgmarkercolor msgid "Marker color" msgstr "" #: lazarusidestrconsts:lisfepaintdesigneritemsonidle msgid "Reduce designer painting" msgstr "" #: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" msgstr "" #: lazarusidestrconsts:dlgenvgrid msgid "Grid" msgstr "" #: lazarusidestrconsts:dlgenvlguidelines msgid "Guide lines" msgstr "" #: lazarusidestrconsts:dlgenvmisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgruberbandselectioncolor msgid "Selection" msgstr "" #: lazarusidestrconsts:dlgruberbandcreationcolor msgid "Creation" msgstr "" #: lazarusidestrconsts:dlgrubberbandselectsgrandchilds msgid "Select grand childs" msgstr "" #: lazarusidestrconsts:dlgrubberbandgroup msgid "Rubber band" msgstr "" #: lazarusidestrconsts:dlgpasext msgid "Default pascal extension" msgstr "" #: lazarusidestrconsts:dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" msgstr "" #: lazarusidestrconsts:dlgambigfileact msgid "Ambiguous file action:" msgstr "Nejednoznačná akce souboru:" #: lazarusidestrconsts:dlgenvask msgid "Ask" msgstr "Zeptat" #: lazarusidestrconsts:dlgautodel msgid "Auto delete file" msgstr "Automaticky smazat soubor" #: lazarusidestrconsts:dlgautoren msgid "Auto rename file lowercase" msgstr "Automaticky nastav malá písmena v názvu souboru" #: lazarusidestrconsts:dlgnoautomaticrenaming msgid "no automatic renaming" msgstr "automatické přejmenovávání ne" #: lazarusidestrconsts:dlgambigwarn msgid "Warn on compile" msgstr "Varování při překládání" #: lazarusidestrconsts:dlgignoreverb msgid "Ignore" msgstr "" #: lazarusidestrconsts:dlgbackcolor msgid "Background" msgstr "Pozadí" #: lazarusidestrconsts:dlgsubpropkcolor msgid "Subpropertes" msgstr "" #: lazarusidestrconsts:dlgreferencecolor msgid "Reference" msgstr "" #: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts:liswladd msgid "&Add" msgstr "&Přidat" #: lazarusidestrconsts:liswlproperties msgid "&Properties" msgstr "&Vlastnosti" #: lazarusidestrconsts:liswlenabled msgid "&Enabled" msgstr "&Povolený" #: lazarusidestrconsts:liswldelete msgid "&Delete" msgstr "&Smazat" #: lazarusidestrconsts:liswldisableall msgid "D&isable All" msgstr "" #: lazarusidestrconsts:liswlenableall msgid "E&nable All" msgstr "&Povolit vše" #: lazarusidestrconsts:liswldeleteall msgid "De&lete All" msgstr "" #: lazarusidestrconsts:dlgdefvaluecolor msgid "Default value" msgstr "" #: lazarusidestrconsts:dlgpropnamecolor msgid "Property name" msgstr "" #: lazarusidestrconsts:dlgoimiscellaneous msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgoiitemheight msgid "Item height" msgstr "" #: lazarusidestrconsts:lisshowhintsinobjectinspector msgid "Show hints in Object Inspector" msgstr "" #: lazarusidestrconsts:dlgenvcolors msgid "Colors" msgstr "" #: lazarusidestrconsts:dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlgdirectorynotfound msgid "Directory not found" msgstr "Složka nenalezena" #: lazarusidestrconsts:lisinstallationfailed msgid "Installation failed" msgstr "" #: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgstr "" #: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "" #: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." msgstr "" #: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." msgstr "Testovací složka \"%s\" nenalezena." #: lazarusidestrconsts:dlgeddisplay msgid "Display" msgstr "Zobrazení" #: lazarusidestrconsts:liseotabwidths msgid "Tab widths" msgstr "" #: lazarusidestrconsts:dlgkeymapping msgid "Key Mappings" msgstr "" #: lazarusidestrconsts:dlgedcolor msgid "Color" msgstr "" #: lazarusidestrconsts:dlgkeymappingerrors msgid "Key mapping errors" msgstr "" #: lazarusidestrconsts:dlgedback msgid "Back" msgstr "Zpět" #: lazarusidestrconsts:dlgreport msgid "Report" msgstr "" #: lazarusidestrconsts:dlgednoerr msgid "No errors in key mapping found." msgstr "" #: lazarusidestrconsts:dlgdeltemplate msgid "Delete template " msgstr "Odstranit šablonu" #: lazarusidestrconsts:dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "" #: lazarusidestrconsts:dlgallfiles msgid "All files" msgstr "Všechny soubory" #: lazarusidestrconsts:lissavefileas msgid "Save file as" msgstr "" #: lazarusidestrconsts:lisopenexistingfile msgid "Open existing file" msgstr "" #: lazarusidestrconsts:lislazarusunit msgid "Lazarus unit" msgstr "" #: lazarusidestrconsts:lislazarusinclude msgid "Lazarus include file" msgstr "" #: lazarusidestrconsts:lislazarusproject msgid "Lazarus project" msgstr "" #: lazarusidestrconsts:lislazarusform msgid "Lazarus form" msgstr "" #: lazarusidestrconsts:lislazaruspackage msgid "Lazarus package" msgstr "" #: lazarusidestrconsts:lislazarusprojectsource msgid "Lazarus project source" msgstr "" #: lazarusidestrconsts:dlgaltsetclmode msgid "Alt-Key sets column mode" msgstr "" #: lazarusidestrconsts:dlgalwaysvisiblecaret msgid "Always visible caret" msgstr "" #: lazarusidestrconsts:dlgautoident msgid "Auto indent" msgstr "Automatické odsazení" #: lazarusidestrconsts:dlgbrachighlight msgid "Bracket highlighting" msgstr "Zvýraznění závorek" #: lazarusidestrconsts:dlgdragdroped msgid "Drag Drop editing" msgstr "Editace s uchop a táhni" #: lazarusidestrconsts:dlgdropfiles msgid "Drop files" msgstr "Umístit soubory" #: lazarusidestrconsts:dlggroupundo msgid "Group Undo" msgstr "" #: lazarusidestrconsts:dlghalfpagescroll msgid "Half page scroll" msgstr "" #: lazarusidestrconsts:dlgkeepcaretx msgid "Keep caret X position" msgstr "" #: lazarusidestrconsts:dlgpersistentcaret msgid "Persistent caret" msgstr "" #: lazarusidestrconsts:dlgcaretskipsselection msgid "Caret skips selection" msgstr "" #: lazarusidestrconsts:dlgrightmousemovescursor msgid "Right mouse moves caret" msgstr "" #: lazarusidestrconsts:dlgscrollbyoneless msgid "Scroll by one less" msgstr "" #: lazarusidestrconsts:dlgscrollpastendfile msgid "Scroll past end of file" msgstr "" #: lazarusidestrconsts:dlgscrollpastendline msgid "Scroll past end of line" msgstr "" #: lazarusidestrconsts:dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "" #: lazarusidestrconsts:dlgshowscrollhint msgid "Show scroll hint" msgstr "" #: lazarusidestrconsts:dlgmouselinks msgid "Mouse links" msgstr "" #: lazarusidestrconsts:dlgshowgutterhints msgid "Show gutter hints" msgstr "" #: lazarusidestrconsts:dlgsmarttabs msgid "Smart tabs" msgstr "" #: lazarusidestrconsts:dlgtabstospaces msgid "Tabs to spaces" msgstr "" #: lazarusidestrconsts:dlgtabindent msgid "Tab indents blocks" msgstr "" #: lazarusidestrconsts:dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "" #: lazarusidestrconsts:dlgundoaftersave msgid "Undo after save" msgstr "" #: lazarusidestrconsts:dlgdoubleclickline msgid "Double click line" msgstr "Dvojklik na řádek" #: lazarusidestrconsts:dlgfindtextatcursor msgid "Find text at cursor" msgstr "" #: lazarusidestrconsts:dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Použít zvýraznění syntaxe" #: lazarusidestrconsts:dlgusecodefolding msgid "Code folding" msgstr "" #: lazarusidestrconsts:dlgcopywordatcursoroncopynone msgid "Copy word on copy none" msgstr "" #: lazarusidestrconsts:dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "" #: lazarusidestrconsts:dlgblockindent msgid "Block indent" msgstr "Odsazení bloku" #: lazarusidestrconsts:dlgundolimit msgid "Undo limit" msgstr "" #: lazarusidestrconsts:dlgtabwidths msgid "Tab widths" msgstr "" #: lazarusidestrconsts:dlgmargingutter msgid "Margin and gutter" msgstr "" #: lazarusidestrconsts:dlgvisiblerightmargin msgid "Visible right margin" msgstr "" #: lazarusidestrconsts:dlgvisiblegutter msgid "Visible gutter" msgstr "" #: lazarusidestrconsts:dlgshowlinenumbers msgid "Show line numbers" msgstr "" #: lazarusidestrconsts:dlgshowcompilinglinenumbers msgid "Show line numbers" msgstr "" #: lazarusidestrconsts:dlgrightmargin msgid "Right margin" msgstr "" #: lazarusidestrconsts:dlgrightmargincolor msgid "Right margin color" msgstr "" #: lazarusidestrconsts:dlggutterwidth msgid "Gutter width" msgstr "" #: lazarusidestrconsts:dlgguttercolor msgid "Gutter color" msgstr "" #: lazarusidestrconsts:dlgeditorfont msgid "Editor font" msgstr "Písmo editoru" #: lazarusidestrconsts:dlgdefaulteditorfont msgid "Default editor font" msgstr "" #: lazarusidestrconsts:dlgeditorfontheight msgid "Editor font height" msgstr "Výška písma editoru" #: lazarusidestrconsts:dlgextralinespacing msgid "Extra line spacing" msgstr "" #: lazarusidestrconsts:dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "" #: lazarusidestrconsts:dlgcheckconsistency msgid "Check consistency" msgstr "" #: lazarusidestrconsts:lisedoptschoosescheme msgid "Choose Scheme" msgstr "" #: lazarusidestrconsts:dlgedhintcommand msgid "Hint: click on the command you want to edit" msgstr "" #: lazarusidestrconsts:dlglang msgid "Language" msgstr "" #: lazarusidestrconsts:dlgclrscheme msgid "Color Scheme" msgstr "" #: lazarusidestrconsts:dlgfileexts msgid "File extensions" msgstr "" #: lazarusidestrconsts:dlgedelement msgid "Element" msgstr "Prvek" #: lazarusidestrconsts:dlgsetelementdefault msgid "Set element to default" msgstr "" #: lazarusidestrconsts:dlgsetallelementdefault msgid "Set all elements to default" msgstr "" #: lazarusidestrconsts:dlgforecolor msgid "Foreground color" msgstr "" #: lazarusidestrconsts:dlgedusedefcolor msgid "Use default color" msgstr "" #: lazarusidestrconsts:dlgtextattributes msgid "Text attributes" msgstr "Vlastnosti textu" #: lazarusidestrconsts:dlgedbold msgid "Bold" msgstr "Tučný" #: lazarusidestrconsts:dlgedital msgid "Italic" msgstr "" #: lazarusidestrconsts:dlgedunder msgid "Underline" msgstr "" #: lazarusidestrconsts:dlgedidcomlet msgid "Identifier completion" msgstr "" #: lazarusidestrconsts:dlgedcodeparams msgid "Code parameters" msgstr "" #: lazarusidestrconsts:dlgtooltipeval msgid "Tooltip expression evaluation" msgstr "" #: lazarusidestrconsts:dlgtooltiptools msgid "Tooltip symbol Tools" msgstr "" #: lazarusidestrconsts:dlgeddelay msgid "Delay" msgstr "" #: lazarusidestrconsts:dlgtimesecondunit msgid "sec" msgstr "" #: lazarusidestrconsts:dlgedcodetempl msgid "Code templates" msgstr "" #: lazarusidestrconsts:dlgtplfname msgid "Template file name" msgstr "" #: lazarusidestrconsts:dlgedadd msgid "Add..." msgstr "Přidat..." #: lazarusidestrconsts:dlgededit msgid "Edit..." msgstr "Upravit..." #: lazarusidestrconsts:dlgeddelete msgid "Delete" msgstr "Odstranit" #: lazarusidestrconsts:dlgindentcodeto msgid "Indent code to" msgstr "" #: lazarusidestrconsts:dlgcodetoolstab msgid "Code Tools" msgstr "" #: lazarusidestrconsts:lisautomaticfeatures msgid "Automatic features" msgstr "Automatická vlastnost" #: lazarusidestrconsts:dlgcfdividerdrawlevel msgid "Divider Draw Level" msgstr "Úroveň kreslení rozdělovače" #: lazarusidestrconsts:dlgcodetoolsopts msgid "CodeTools Options" msgstr "" #: lazarusidestrconsts:dlgcodecreation msgid "Code Creation" msgstr "" #: lazarusidestrconsts:dlgwordspolicies msgid "Words" msgstr "Slova" #: lazarusidestrconsts:dlglinesplitting msgid "Line Splitting" msgstr "" #: lazarusidestrconsts:dlgspacenotcosmos msgid "Space" msgstr "" #: lazarusidestrconsts:dlgidentifiercompletion msgid "Identifier completion" msgstr "" #: lazarusidestrconsts:dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" msgstr "Doplňující zdrojové prohledávácí cesty pro všechny projekty(.pp;.pas)" #: lazarusidestrconsts:dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "" #: lazarusidestrconsts:dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Přizpůsobit vrchní linku kvůli komentářú vpředu" #: lazarusidestrconsts:dlgcentercursorline msgid "Center Cursor Line" msgstr "" #: lazarusidestrconsts:dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "" #: lazarusidestrconsts:dlgclassinsertpolicy msgid "Class part insert policy" msgstr "" #: lazarusidestrconsts:dlgalphabetically msgid "Alphabetically" msgstr "Abecedně" #: lazarusidestrconsts:dlgcdtlast msgid "Last" msgstr "" #: lazarusidestrconsts:dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "" #: lazarusidestrconsts:dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "" #: lazarusidestrconsts:dlglast msgid "Last (i.e. at end of source)" msgstr "" #: lazarusidestrconsts:dlginfrontofmethods msgid "In front of methods" msgstr "" #: lazarusidestrconsts:dlgbehindmethods msgid "Behind methods" msgstr "Za metodami" #: lazarusidestrconsts:dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "" #: lazarusidestrconsts:dlgmethodinspolicy msgid "Method insert policy" msgstr "Způsob vkládání metod" #: lazarusidestrconsts:dlgcdtclassorder msgid "Class order" msgstr "" #: lazarusidestrconsts:dlgkeywordpolicy msgid "Keyword policy" msgstr "" #: lazarusidestrconsts:dlgcdtlower msgid "lowercase" msgstr "" #: lazarusidestrconsts:dlgcdtuppercase msgid "UPPERCASE" msgstr "VELKÁ PÍSMENA" #: lazarusidestrconsts:dlg1up2low msgid "Lowercase, first letter up" msgstr "" #: lazarusidestrconsts:dlgidentifierpolicy msgid "Identifier policy" msgstr "" #: lazarusidestrconsts:dlgpropertycompletion msgid "Property completion" msgstr "" #: lazarusidestrconsts:lisheadercommentforclass msgid "Header comment for class" msgstr "" #: lazarusidestrconsts:dlgcompleteproperties msgid "Complete properties" msgstr "Vlastnosti dokončení" #: lazarusidestrconsts:dlgcdtreadprefix msgid "Read prefix" msgstr "" #: lazarusidestrconsts:dlgcdtwriteprefix msgid "Write prefix" msgstr "Prefix zápisu" #: lazarusidestrconsts:dlgcdtstoredpostfix msgid "Stored postfix" msgstr "" #: lazarusidestrconsts:dlgcdtvariableprefix msgid "Variable prefix" msgstr "Prefix proměnné" #: lazarusidestrconsts:dlgsetpropertyvariable msgid "Set property Variable" msgstr "" #: lazarusidestrconsts:dlgmaxlinelength msgid "Max line length:" msgstr "" #: lazarusidestrconsts:dlgnotsplitlinefront msgid "Do not split line In front of:" msgstr "Nerozdělovat řádek před:" #: lazarusidestrconsts:dlgnotsplitlineafter msgid "Do not split line after:" msgstr "Nerozdělovat řádek po:" #: lazarusidestrconsts:dlgcdtpreview msgid "Preview (Max line length = 1)" msgstr "Náhled (max. délka řádku = 1)" #: lazarusidestrconsts:dlginsspacefront msgid "Insert space in front of" msgstr "" #: lazarusidestrconsts:dlginsspaceafter msgid "Insert space after" msgstr "" #: lazarusidestrconsts:dlgwrdpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts:dlgaddsemicolon msgid "Add semicolon" msgstr "Přidat středník" #: lazarusidestrconsts:dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "Přidat operátor přiřazení :=" #: lazarusidestrconsts:locwndsrceditor msgid "Lazarus Source Editor" msgstr "" #: lazarusidestrconsts:dlgcompileroptions msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" msgstr "" #: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "" #: lazarusidestrconsts:dlgsearchpaths msgid "Paths" msgstr "" #: lazarusidestrconsts:dlgcoparsing msgid "Parsing" msgstr "" #: lazarusidestrconsts:dlgcodegeneration msgid "Code" msgstr "" #: lazarusidestrconsts:dlgcolinking msgid "Linking" msgstr "" #: lazarusidestrconsts:dlgcomessages msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:dlgcoother msgid "Other" msgstr "" #: lazarusidestrconsts:dlgcoinherited msgid "Inherited" msgstr "" #: lazarusidestrconsts:dlgcocompilation msgid "Compilation" msgstr "" #: lazarusidestrconsts:lisbrowseforcompiler msgid "Browse for Compiler (%s)" msgstr "Procházet pro překladač" #: lazarusidestrconsts:lisunitoutputdirectory msgid "Unit Output directory" msgstr "" #: lazarusidestrconsts:lisselectanode msgid "Select a node" msgstr "" #: lazarusidestrconsts:dlgshowcompileroptions msgid "Show compiler options" msgstr "" #: lazarusidestrconsts:dlgcoopts msgid "Options: " msgstr "" #: lazarusidestrconsts:dlgcoasmstyle msgid "Assembler style:" msgstr "Styl assembleru:" #: lazarusidestrconsts:lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "Nezděděny žádné volby překladače " #: lazarusidestrconsts:lisunitpath msgid "unit path" msgstr "" #: lazarusidestrconsts:lisincludepath msgid "include path" msgstr "" #: lazarusidestrconsts:lisobjectpath msgid "object path" msgstr "" #: lazarusidestrconsts:lislibrarypath msgid "library path" msgstr "" #: lazarusidestrconsts:lislinkeroptions msgid "linker options" msgstr "" #: lazarusidestrconsts:liscustomoptions msgid "custom options" msgstr "" #: lazarusidestrconsts:dlgcoasis msgid "As-Is" msgstr "" #: lazarusidestrconsts:dlgsyntaxoptions msgid "Syntax options" msgstr "" #: lazarusidestrconsts:dlgassemblerdefault msgid "Default" msgstr "" #: lazarusidestrconsts:dlgdelphi2ext msgid "Delphi 2 Extensions" msgstr "Rozšíření Delphi 2" #: lazarusidestrconsts:dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" msgstr "Operátory ve stylu C (*=, +=, /= and -=)" #: lazarusidestrconsts:dlgassertcode msgid "Include Assertion Code" msgstr "" #: lazarusidestrconsts:dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Povolit LABEL a GOTO" #: lazarusidestrconsts:dlgcppinline msgid "C++ Styled INLINE" msgstr "INLINE ve stylu C++" #: lazarusidestrconsts:dlgcmacro msgid "C Style Macros (global)" msgstr "Makra ve stylu C (globální)" #: lazarusidestrconsts:dlgbp7cptb msgid "TP/BP 7.0 Compatible" msgstr "" #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "" #: lazarusidestrconsts:dlgstatickeyword msgid "Static Keyword in Objects" msgstr "" #: lazarusidestrconsts:dlgdeplhicomp msgid "Delphi Compatible" msgstr "Kompatibilní s Delphi" #: lazarusidestrconsts:dlgcoansistr msgid "Use Ansi Strings" msgstr "" #: lazarusidestrconsts:dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" msgstr "" #: lazarusidestrconsts:dlgcounitstyle msgid "Unit Style:" msgstr "" #: lazarusidestrconsts:dlgcosmartlinkable msgid "Smart Linkable" msgstr "" #: lazarusidestrconsts:dlgcochecks msgid "Checks:" msgstr "" #: lazarusidestrconsts:dlgcorange msgid "Range" msgstr "" #: lazarusidestrconsts:dlgcooverflow msgid "Overflow" msgstr "" #: lazarusidestrconsts:dlgcostack msgid "Stack" msgstr "" #: lazarusidestrconsts:dlgheapsize msgid "Heap Size" msgstr "" #: lazarusidestrconsts:dlgcogenerate msgid "Generate:" msgstr "" #: lazarusidestrconsts:dlgconormal msgid "Normal Code" msgstr "" #: lazarusidestrconsts:dlgcofast msgid "Faster Code" msgstr "" #: lazarusidestrconsts:dlgcosmaller msgid "Smaller Code" msgstr "" #: lazarusidestrconsts:dlgtargetproc msgid "Target i386" msgstr "" #: lazarusidestrconsts:dlgtargetplatform msgid "Target Platform:" msgstr "" #: lazarusidestrconsts:dlgoptimiz msgid "Optimizations:" msgstr "" #: lazarusidestrconsts:dlgcokeepvarsreg msgid "Keep certain variables in registers" msgstr "" #: lazarusidestrconsts:dlguncertopt msgid "Uncertain Optimizations" msgstr "" #: lazarusidestrconsts:dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel1opt msgid "Level 1 (quick and debugger friendly)" msgstr "" #: lazarusidestrconsts:dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" msgstr "" #: lazarusidestrconsts:dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" msgstr "" #: lazarusidestrconsts:dlgtargetos msgid "Target OS" msgstr "" #: lazarusidestrconsts:dlgtargetcpu msgid "Target CPU" msgstr "" #: lazarusidestrconsts:dlgcodebugging msgid "Debugging:" msgstr "" #: lazarusidestrconsts:dlgcogdb msgid "Generate Debugging Info For GDB (Slows Compiling)" msgstr "" #: lazarusidestrconsts:dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" msgstr "" #: lazarusidestrconsts:dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování" #: lazarusidestrconsts:dlgcoheaptrc msgid "Use Heaptrc Unit" msgstr "" #: lazarusidestrconsts:dlgcovalgrind msgid "Generate code for valgrind" msgstr "" #: lazarusidestrconsts:dlggprof msgid "Generate code for gprof" msgstr "" #: lazarusidestrconsts:dlgcostrip msgid "Strip Symbols From Executable" msgstr "" #: lazarusidestrconsts:dlglinklibraries msgid "Link Style:" msgstr "" #: lazarusidestrconsts:dlglinksmart msgid "Link Smart" msgstr "" #: lazarusidestrconsts:dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" msgstr "" #: lazarusidestrconsts:liscotargetosspecificoptions msgid "Target OS specific options" msgstr "" #: lazarusidestrconsts:dlgwin32guiapp msgid "Win32 gui application" msgstr "Win32 GUI aplikace" #: lazarusidestrconsts:dlgverbosity msgid "Verbosity during compilation:" msgstr "Užvaněnost během překládání:" #: lazarusidestrconsts:dlgcoshowerr msgid "Show Errors" msgstr "" #: lazarusidestrconsts:dlgshowwarnings msgid "Show Warnings" msgstr "" #: lazarusidestrconsts:dlgshownotes msgid "Show Notes" msgstr "" #: lazarusidestrconsts:dlgshowhint msgid "Show Hints" msgstr "" #: lazarusidestrconsts:dlgshowgeneralinfo msgid "Show general info" msgstr "" #: lazarusidestrconsts:dlgshowprocserror msgid "Show all procs on error" msgstr "" #: lazarusidestrconsts:dlgshoweverything msgid "Show everything" msgstr "" #: lazarusidestrconsts:dlgshowsummary msgid "Show summary" msgstr "" #: lazarusidestrconsts:dlgshowdebuginfo msgid "Show debug info" msgstr "" #: lazarusidestrconsts:dlgshowusedfiles msgid "Show used files" msgstr "" #: lazarusidestrconsts:dlgshowtriedfiles msgid "Show tried files" msgstr "" #: lazarusidestrconsts:dlgshowdefinedmacros msgid "Show defined macros" msgstr "" #: lazarusidestrconsts:dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "" #: lazarusidestrconsts:dlgshowconditionals msgid "Show conditionals" msgstr "" #: lazarusidestrconsts:dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "" #: lazarusidestrconsts:dlgshownothing msgid "Show nothing (only errors)" msgstr "" #: lazarusidestrconsts:dlgwritefpclogo msgid "Write an FPC logo" msgstr "Zapsat FPC logo" #: lazarusidestrconsts:dlghintsunused msgid "Show Hints for unused units in main source" msgstr "" #: lazarusidestrconsts:dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" msgstr "" #: lazarusidestrconsts:dlgconfigfiles msgid "Config Files:" msgstr "Konfigurační soubory:" #: lazarusidestrconsts:dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)" #: lazarusidestrconsts:dlgusecustomconfig msgid "Use addional Compiler Config File" msgstr "" #: lazarusidestrconsts:liscustomoptions2 msgid "Custom options" msgstr "" #: lazarusidestrconsts:dlgstopafternrerr msgid "Stop after number of errors:" msgstr "" #: lazarusidestrconsts:dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "" #: lazarusidestrconsts:dlgcoincfiles msgid "Include Files (-Fi):" msgstr "" #: lazarusidestrconsts:dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "" #: lazarusidestrconsts:dlgcolibraries msgid "Libraries (-Fl):" msgstr "" #: lazarusidestrconsts:dlgcodebugpath msgid "Debugger path addition (none):" msgstr "" #: lazarusidestrconsts:liscompiler msgid "Compiler" msgstr "Překladač" #: lazarusidestrconsts:listofpcpath msgid "Path:" msgstr "" #: lazarusidestrconsts:liscoskipcallingcompiler msgid "Skip calling Compiler" msgstr "" #: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "Nejednoznačný přídavný konfigurační soubor překladače" #: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá FreePascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace." #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat." #: lazarusidestrconsts:liscocallon msgid "Call on:" msgstr "" #: lazarusidestrconsts:liscocalloncompile msgid "Compile" msgstr "" #: lazarusidestrconsts:liscocallonbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:liscocallonrun msgid "Run" msgstr "" #: lazarusidestrconsts:dlgcocreatemakefile msgid "Create Makefile" msgstr "" #: lazarusidestrconsts:liscoexecuteafter msgid "Execute after" msgstr "" #: lazarusidestrconsts:liscoexecutebefore msgid "Execute before" msgstr "" #: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Přídavné volby překladače zděděné z balíčků." #: lazarusidestrconsts:liscocommand msgid "Command:" msgstr "" #: lazarusidestrconsts:liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "" #: lazarusidestrconsts:liscoscanformakemessages msgid "Scan for Make messages" msgstr "" #: lazarusidestrconsts:liscoshowallmessages msgid "Show all messages" msgstr "" #: lazarusidestrconsts:dlgunitoutp msgid "Unit output directory (-FU):" msgstr "" #: lazarusidestrconsts:liscodefault msgid "default (%s)" msgstr "" #: lazarusidestrconsts:dlgbutapply msgid "Apply" msgstr "Použít" #: lazarusidestrconsts:dlgcoshowoptions msgid "Show Options" msgstr "" #: lazarusidestrconsts:dlgcoloadsave msgid "Load/Save" msgstr "" #: lazarusidestrconsts:dlgmainviewforms msgid "View project forms" msgstr "" #: lazarusidestrconsts:dlgmainviewunits msgid "View project units" msgstr "" #: lazarusidestrconsts:dlgmultiselect msgid "Multi Select" msgstr "" #: lazarusidestrconsts:dlgccocaption msgid "Checking compiler options" msgstr "" #: lazarusidestrconsts:dlgccotest msgid "Test" msgstr "Test" #: lazarusidestrconsts:dlgccoresults msgid "Results" msgstr "" #: lazarusidestrconsts:lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "" #: lazarusidestrconsts:lisccocontains msgid "contains " msgstr "" #: lazarusidestrconsts:lisccospaces msgid "spaces" msgstr "" #: lazarusidestrconsts:lisccospecialcharacters msgid "special characters" msgstr "" #: lazarusidestrconsts:lisccononascii msgid "non ASCII" msgstr "" #: lazarusidestrconsts:lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "špatný oddělovač cest" #: lazarusidestrconsts:lisccounusualchars msgid "unusual characters" msgstr "neobvyklé znaky" #: lazarusidestrconsts:lisccohasnewline msgid "new line symbols" msgstr "nové řádkové symboly" #: lazarusidestrconsts:lisccoinvalidsearchpath msgid "Invalid search path" msgstr "" #: lazarusidestrconsts:lisccoskip msgid "Skip" msgstr "" #: lazarusidestrconsts:dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "Test: Kontrola překladače..." #: lazarusidestrconsts:lisccoinvalidcompiler msgid "Invalid compiler" msgstr "" #: lazarusidestrconsts:lisccocompilernotanexe msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "" #: lazarusidestrconsts:lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "Nejednoznačný překladač" #: lazarusidestrconsts:lisccoseveralcompilers msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "" #: lazarusidestrconsts:dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." msgstr "Test: Kontrola nastavení fpc..." #: lazarusidestrconsts:liscconocfgfound msgid "no fpc.cfg found" msgstr "" #: lazarusidestrconsts:lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "" #: lazarusidestrconsts:dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "Test: Překládání prázdného souboru..." #: lazarusidestrconsts:lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "" #: lazarusidestrconsts:lisccochecktestdir msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects" msgstr "" #: lazarusidestrconsts:lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "" #: lazarusidestrconsts:lisccounabletocreatetestpascalfile msgid "Unable to create Test pascal file \"%s\"." msgstr "" #: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "Test: Překládání prázdného souboru." #: lazarusidestrconsts:lisccorelunitpathfoundincfg msgid "relative unit path found in fpc cfg: %s" msgstr "" #: lazarusidestrconsts:dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "Test: Kontrola nastavení překladače..." #: lazarusidestrconsts:lisccoenglishmessagefilemissing msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg" msgstr "" #: lazarusidestrconsts:lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" msgstr "" #: lazarusidestrconsts:lisccomissingunit msgid "Missing unit" msgstr "Chybějcí jednotka" #: lazarusidestrconsts:lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." msgstr "" #: lazarusidestrconsts:dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." msgstr "Test: Kontrola chybějících fpc ppu..." #: lazarusidestrconsts:dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "Test: Kontrola datumu překladače..." #: lazarusidestrconsts:lisccoerrorcaption msgid "Error" msgstr "" #: lazarusidestrconsts:lisccounabletogetfiledate msgid "Unable to get file date of %s." msgstr "Nelze získat datum souboru %s." #: lazarusidestrconsts:lisccowarningcaption msgid "Warning" msgstr "Varování" #: lazarusidestrconsts:lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "" #: lazarusidestrconsts:lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "" #: lazarusidestrconsts:lisccoppuexiststwice msgid "ppu exists twice: %s, %s" msgstr "" #: lazarusidestrconsts:dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..." #: lazarusidestrconsts:lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "" #: lazarusidestrconsts:lisccotestssuccess msgid "All tests succeeded." msgstr "Všechny testy se zdařily." #: lazarusidestrconsts:lisccowarningmsg msgid "WARNING: " msgstr "VAROVÁNÍ: " #: lazarusidestrconsts:lisccohintmsg msgid "HINT: " msgstr "" #: lazarusidestrconsts:lisccoerrormsg msgid "ERROR: " msgstr "" #: lazarusidestrconsts:dlgcommandlineparameters msgid "Command line parameters" msgstr "" #: lazarusidestrconsts:dlgprojectoptions msgid "Project Options" msgstr "Volby projektu" #: lazarusidestrconsts:dlgpoapplication msgid "Application" msgstr "Aplikace" #: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." msgstr "Aplikace%sGrafický program LCL/FreePascal. Soubor programu je automaticky spravován Lazarusem." #: lazarusidestrconsts:dlgpofroms msgid "Forms" msgstr "" #: lazarusidestrconsts:dlgpomisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgpoi18n msgid "i18n" msgstr "" #: lazarusidestrconsts:rsenablei18n msgid "Enable i18n" msgstr "Povolit i18n" #: lazarusidestrconsts:rsi18noptions msgid "i18n Options" msgstr "" #: lazarusidestrconsts:rspooutputdirectory msgid "PO Output Directory:" msgstr "" #: lazarusidestrconsts:rsincludeversioninfoinexecutable msgid "Include Version Info in executable" msgstr "" #: lazarusidestrconsts:rsversionnumbering msgid "Version numbering" msgstr "Číslování verze" #: lazarusidestrconsts:rsversion msgid "Version:" msgstr "Verze:" #: lazarusidestrconsts:rsmajorrevision msgid "Major revision:" msgstr "" #: lazarusidestrconsts:rsminorrevision msgid "Minor revision:" msgstr "Minoritní verze:" #: lazarusidestrconsts:rsbuild msgid "Build:" msgstr "Sestavení:" #: lazarusidestrconsts:rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "Automaticky zvyšovat číslo sestavení" #: lazarusidestrconsts:rslanguageoptions msgid "Language options" msgstr "" #: lazarusidestrconsts:rslanguageselection msgid "Language selection:" msgstr "" #: lazarusidestrconsts:rscharacterset msgid "Character set:" msgstr "" #: lazarusidestrconsts:rsotherinfo msgid "Other info" msgstr "" #: lazarusidestrconsts:rscopyright msgid "Copyright:" msgstr "Kopírovací práva:" #: lazarusidestrconsts:rsadditionalinfo msgid "Additional info" msgstr "Doplňující informace" #: lazarusidestrconsts:dlgposavesession msgid "Session" msgstr "" #: lazarusidestrconsts:dlgapplicationsettings msgid "Application Settings" msgstr "Nastavení aplikace" #: lazarusidestrconsts:dlgpotitle msgid "Title:" msgstr "" #: lazarusidestrconsts:dlgpooutputsettings msgid "Output Settings" msgstr "" #: lazarusidestrconsts:dlgpotargetfilename msgid "Target file name:" msgstr "" #: lazarusidestrconsts:dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" msgstr "" #: lazarusidestrconsts:dlgpousemanifest msgid "Use manifest file to enable themes (windows only)" msgstr "Použít soubor manifest k povolení grafických stylů (pouze Windows)" #: lazarusidestrconsts:dlgautocreateforms msgid "Auto-create forms:" msgstr "Automaticky vytvořené formuláře:" #: lazarusidestrconsts:dlgavailableforms msgid "Available forms:" msgstr "Dostupné formuláře:" #: lazarusidestrconsts:dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" msgstr "Při vytváření nových forem je přidej do automaticky vytvářených forem." #: lazarusidestrconsts:dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "" #: lazarusidestrconsts:dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "" #: lazarusidestrconsts:lismainunitispascalsource msgid "Main Unit is Pascal Source" msgstr "" #: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" msgstr "" #: lazarusidestrconsts:lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" msgstr "" #: lazarusidestrconsts:lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" msgstr "" #: lazarusidestrconsts:lisprojectisrunnable msgid "Project is runnable" msgstr "" #: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Vždy sestavit (i pokud se nic nezmění)" #: lazarusidestrconsts:dlgrunparameters msgid "Run parameters" msgstr "" #: lazarusidestrconsts:dlgrunolocal msgid "Local" msgstr "" #: lazarusidestrconsts:dlgrunoenvironment msgid "Environment" msgstr "" #: lazarusidestrconsts:dlghostapplication msgid "Host application" msgstr "" #: lazarusidestrconsts:dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "" #: lazarusidestrconsts:dlguselaunchingapp msgid "Use launching application" msgstr "Použít spouštěcí aplikaci" #: lazarusidestrconsts:lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "" #: lazarusidestrconsts:dlgroworkingdirectory msgid "Working directory" msgstr "Pracovní složka:" #: lazarusidestrconsts:dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts:dlgrunousedisplay msgid "Use display" msgstr "" #: lazarusidestrconsts:dlgrunosystemvariables msgid "System variables" msgstr "" #: lazarusidestrconsts:dlgrunovariable msgid "Variable" msgstr "Proměnná" #: lazarusidestrconsts:dlgrunovalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts:dlgrunouseroverrides msgid "User overrides" msgstr "Uživatelské předefinování" #: lazarusidestrconsts:dlgincludesystemvariables msgid "Include system variables" msgstr "" #: lazarusidestrconsts:dlgdirectorydoesnotexist msgid "Directory does not exist" msgstr "Složka neexistuje" #: lazarusidestrconsts:lisrunparamsfilenotexecutable msgid "File not executable" msgstr "" #: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "" #: lazarusidestrconsts:dlgthedirectory msgid "The directory \"" msgstr "" #: lazarusidestrconsts:dlgdoesnotexist msgid "\" does not exist." msgstr "\" neexistuje." #: lazarusidestrconsts:dlgtexttofing msgid "&Text to Find" msgstr "&Text k nalezení" #: lazarusidestrconsts:dlgreplacewith msgid "&Replace With" msgstr "&Nahradit s" #: lazarusidestrconsts:dlgfropts msgid "Options" msgstr "" #: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor ..." msgstr "Když tento soubor je aktivní v editoru ..." #: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts:liscefilter msgid "(Filter)" msgstr "(Filtr)" #: lazarusidestrconsts:dlgcasesensitive msgid "Case Sensitive" msgstr "" #: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Rozlišovat velká a malá písmena např. A a a" #: lazarusidestrconsts:dlgwholewordsonly msgid "Whole Words Only" msgstr "Pouze celá slova" #: lazarusidestrconsts:lisonlysearchforwholewords msgid "Only search for whole words" msgstr "" #: lazarusidestrconsts:dlgregularexpressions msgid "Regular Expressions" msgstr "" #: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)" #: lazarusidestrconsts:dlgmultiline msgid "Multiline" msgstr "" #: lazarusidestrconsts:lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Povolit vyhledávání více řádků" #: lazarusidestrconsts:dlgpromptonreplace msgid "Prompt On Replace" msgstr "" #: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Zeptat před nahrazením každého nalezeného textu" #: lazarusidestrconsts:dlgsrorigin msgid "Origin" msgstr "" #: lazarusidestrconsts:lispldexists msgid "Exists" msgstr "" #: lazarusidestrconsts:dlgfromcursor msgid "From Cursor" msgstr "" #: lazarusidestrconsts:dlgentirescope msgid "Entire Scope" msgstr "" #: lazarusidestrconsts:dlgscope msgid "Scope" msgstr "" #: lazarusidestrconsts:liswithrequiredpackages msgid "With required packages" msgstr "S požadovanými balíčky" #: lazarusidestrconsts:lislevels msgid "Levels" msgstr "" #: lazarusidestrconsts:lisshowpackages msgid "Show packages" msgstr "" #: lazarusidestrconsts:lisshowunits msgid "Show units" msgstr "" #: lazarusidestrconsts:lisshowidentifiers msgid "Show identifiers" msgstr "" #: lazarusidestrconsts:lisfilter msgid "Filter" msgstr "" #: lazarusidestrconsts:lisprivate msgid "Private" msgstr "Soukromý" #: lazarusidestrconsts:lisprotected msgid "Protected" msgstr "" #: lazarusidestrconsts:lisexpandallpackages msgid "Expand all packages" msgstr "" #: lazarusidestrconsts:liscollapseallpackages msgid "Collapse all packages" msgstr "" #: lazarusidestrconsts:lisexpandallunits msgid "Expand all units" msgstr "" #: lazarusidestrconsts:liscollapseallunits msgid "Collapse all units" msgstr "" #: lazarusidestrconsts:lisexpandallclasses msgid "Expand all classes" msgstr "" #: lazarusidestrconsts:liscollapseallclasses msgid "Collapse all classes" msgstr "" #: lazarusidestrconsts:lisexport msgid "Export ..." msgstr "" #: lazarusidestrconsts:lisbegins msgid "begins" msgstr "začátky" #: lazarusidestrconsts:lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "" #: lazarusidestrconsts:lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "" #: lazarusidestrconsts:lispackagenamebeginswith msgid "Package name begins with ..." msgstr "" #: lazarusidestrconsts:liscontains msgid "contains" msgstr "" #: lazarusidestrconsts:lisidentifiercontains msgid "Identifier contains ..." msgstr "" #: lazarusidestrconsts:lisunitnamecontains msgid "Unit name contains ..." msgstr "" #: lazarusidestrconsts:lispackagenamecontains msgid "Package name contains ..." msgstr "" #: lazarusidestrconsts:lisfriincurrentunit msgid "in current unit" msgstr "" #: lazarusidestrconsts:lisfriinmainproject msgid "in main project" msgstr "" #: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "" #: lazarusidestrconsts:lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "" #: lazarusidestrconsts:lisfrirenameallreferences msgid "Rename all References" msgstr "" #: lazarusidestrconsts:dlgglobal msgid "Global" msgstr "" #: lazarusidestrconsts:lisplduser msgid "User" msgstr "Uživatel" #: lazarusidestrconsts:dlgselectedtext msgid "Selected Text" msgstr "" #: lazarusidestrconsts:dlgdirection msgid "Direction" msgstr "Směr" #: lazarusidestrconsts:lisfrforwardsearch msgid "Forward search" msgstr "" #: lazarusidestrconsts:lisfrbackwardsearch msgid "Backward search" msgstr "Hledání dozadu" #: lazarusidestrconsts:dlgupword msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts:dlgdownword msgid "Down" msgstr "Dolů" #: lazarusidestrconsts:dlgreplaceall msgid "Replace &All" msgstr "" #: lazarusidestrconsts:dlggetposition msgid "Get position" msgstr "" #: lazarusidestrconsts:dlgleftpos msgid "Left:" msgstr "" #: lazarusidestrconsts:dlgwidthpos msgid "Width:" msgstr "Šířka:" #: lazarusidestrconsts:dlgtoppos msgid "Top:" msgstr "" #: lazarusidestrconsts:dlgheightpos msgid "Height:" msgstr "" #: lazarusidestrconsts:rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Uživatelské nastavení manažeru oken" #: lazarusidestrconsts:rsiwpdefault msgid "Default" msgstr "" #: lazarusidestrconsts:rsiwprestorewindowgeometry msgid "Restore window geometry" msgstr "" #: lazarusidestrconsts:rsiwpdocked msgid "Docked" msgstr "Ukotvený" #: lazarusidestrconsts:rsiwpcustomposition msgid "Custom position" msgstr "" #: lazarusidestrconsts:rsiwprestorewindowsize msgid "Restore window size" msgstr "" #: lazarusidestrconsts:liscodeexplorer msgid "Code Explorer" msgstr "" #: lazarusidestrconsts:uemfinddeclaration msgid "&Find Declaration" msgstr "&Najít deklaraci" #: lazarusidestrconsts:uemopenfileatcursor msgid "&Open file at cursor" msgstr "&Otevřít soubor na pozici kurzoru" #: lazarusidestrconsts:uemprocedurejump msgid "Procedure Jump" msgstr "" #: lazarusidestrconsts:uemclosepage msgid "&Close Page" msgstr "&Zavřít stránku" #: lazarusidestrconsts:uemcut msgid "Cut" msgstr "" #: lazarusidestrconsts:uemcopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:uempaste msgid "Paste" msgstr "" #: lazarusidestrconsts:uemcopyfilename msgid "Copy filename" msgstr "Kopírovat soubor" #: lazarusidestrconsts:uemgotobookmark msgid "&Goto Bookmark" msgstr "&Skok na značku" #: lazarusidestrconsts:uemsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts:uemnextbookmark msgid "Goto next Bookmark" msgstr "" #: lazarusidestrconsts:uemprevbookmark msgid "Goto previous Bookmark" msgstr "" #: lazarusidestrconsts:uembookmarkn msgid "Bookmark" msgstr "Značka" #: lazarusidestrconsts:lisopenlfm msgid "Open %s" msgstr "" #: lazarusidestrconsts:uemsetbookmark msgid "&Set Bookmark" msgstr "&Nastavit značku" #: lazarusidestrconsts:uemreadonly msgid "Read Only" msgstr "" #: lazarusidestrconsts:uemshowlinenumbers msgid "Show Line Numbers" msgstr "" #: lazarusidestrconsts:uemshowunitinfo msgid "Unit Info" msgstr "" #: lazarusidestrconsts:uemdebugword msgid "Debug" msgstr "" #: lazarusidestrconsts:uemaddbreakpoint msgid "&Add Breakpoint" msgstr "&Přidat bod přerušení" #: lazarusidestrconsts:uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Přidat &Sledování v místě kurzoru" #: lazarusidestrconsts:uemruntocursor msgid "&Run to Cursor" msgstr "&Spustit po kurzor" #: lazarusidestrconsts:uemviewcallstack msgid "View Call Stack" msgstr "" #: lazarusidestrconsts:uemmoveeditorleft msgid "Move Editor Left" msgstr "" #: lazarusidestrconsts:uemmoveeditorright msgid "Move Editor Right" msgstr "" #: lazarusidestrconsts:uemrefactor msgid "Refactoring" msgstr "" #: lazarusidestrconsts:uemcompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts:uemencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts:uemextractproc msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts:ueminvertassignment msgid "Invert Assignment" msgstr "" #: lazarusidestrconsts:uemfindidentifierreferences msgid "Find Identifier References" msgstr "" #: lazarusidestrconsts:uemrenameidentifier msgid "Rename Identifier" msgstr "" #: lazarusidestrconsts:uemeditorproperties msgid "Editor properties" msgstr "Vlastnosti editoru" #: lazarusidestrconsts:uenotimplcap msgid "Not implemented yet" msgstr "" #: lazarusidestrconsts:uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" msgstr "" #: lazarusidestrconsts:uenotimplcapagain msgid "I told You: Not implemented yet" msgstr "" #: lazarusidestrconsts:uefilerocap msgid "File is readonly" msgstr "" #: lazarusidestrconsts:uefilerotext1 msgid "The file \"" msgstr "" #: lazarusidestrconsts:uefilerotext2 msgid "\" is not writable." msgstr "\" není zapisovatelný." #: lazarusidestrconsts:uemodified msgid "Modified" msgstr "Změněný" #: lazarusidestrconsts:uepreadonly msgid "Readonly" msgstr "" #: lazarusidestrconsts:uepins msgid "INS" msgstr "" #: lazarusidestrconsts:uepovr msgid "OVR" msgstr "" #: lazarusidestrconsts:lisuefontwith msgid "Font without UTF-8" msgstr "" #: lazarusidestrconsts:lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgstr "" #: lazarusidestrconsts:lisuedonotsho msgid "Do not show this message again." msgstr "Neukazovat znova tuto zprávu." #: lazarusidestrconsts:ueminserttodo msgid "Insert Todo" msgstr "" #: lazarusidestrconsts:lisinvalidmultiselection msgid "Invalid multiselection" msgstr "" #: lazarusidestrconsts:lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "" #: lazarusidestrconsts:lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "" #: lazarusidestrconsts:liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "" #: lazarusidestrconsts:liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "" #: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts:lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "" #: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "" #: lazarusidestrconsts:liserrorin msgid "Error in %s" msgstr "" #: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename msgid "There is already another component with the name %s%s%s." msgstr "" #: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%shas created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts:fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "" #: lazarusidestrconsts:lisinvaliddelete msgid "Invalid delete" msgstr "" #: lazarusidestrconsts:listherootcomponentcannotbedeleted msgid "The root component can not be deleted." msgstr "" #: lazarusidestrconsts:fdmalignword msgid "Align" msgstr "Zarovnat" #: lazarusidestrconsts:fdmmirrorhorizontal msgid "Mirror horizontal" msgstr "Zrcadlit vodorovně" #: lazarusidestrconsts:fdmmirrorvertical msgid "Mirror vertical" msgstr "Zrcadlit svisle" #: lazarusidestrconsts:fdmscaleword msgid "Scale" msgstr "" #: lazarusidestrconsts:fdmsizeword msgid "Size" msgstr "" #: lazarusidestrconsts:fdmtaborder msgid "Tab order..." msgstr "" #: lazarusidestrconsts:fdmorder msgid "Order" msgstr "" #: lazarusidestrconsts:fdmordermovetofront msgid "Move to front" msgstr "" #: lazarusidestrconsts:fdmordermovetoback msgid "Move to back" msgstr "" #: lazarusidestrconsts:fdmorderforwardone msgid "Forward one" msgstr "" #: lazarusidestrconsts:fdmorderbackone msgid "Back one" msgstr "Zpět o jeden" #: lazarusidestrconsts:fdmdeleteselection msgid "Delete selection" msgstr "Odstranit výběr" #: lazarusidestrconsts:lischangeclass msgid "Change Class" msgstr "" #: lazarusidestrconsts:fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "" #: lazarusidestrconsts:lisviewsourcelfm msgid "View Source (.lfm)" msgstr "" #: lazarusidestrconsts:fdmsaveformasxml msgid "Save form as xml" msgstr "" #: lazarusidestrconsts:fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "" #: lazarusidestrconsts:fdmshowoptions msgid "Show Options for form editing" msgstr "" #: lazarusidestrconsts:srkmeditkeys msgid "Edit Keys" msgstr "Upravit klávesy" #: lazarusidestrconsts:srkmcommand msgid "Command:" msgstr "" #: lazarusidestrconsts:srkmconflic msgid "Conflict " msgstr "" #: lazarusidestrconsts:srkmconflicw msgid " conflicts with " msgstr " konflikt s " #: lazarusidestrconsts:srkmcommand1 msgid " command1 \"" msgstr " příkaz1 \"" #: lazarusidestrconsts:srkmcommand2 msgid " command2 \"" msgstr " příkaz2 \"" #: lazarusidestrconsts:srkmeditforcmd msgid "Edit keys for command" msgstr "Upravit povely klávec" #: lazarusidestrconsts:srkmkey msgid "Key (or 2 keys combination)" msgstr "" #: lazarusidestrconsts:srkmgrabkey msgid "Grab key" msgstr "" #: lazarusidestrconsts:srkmgrabsecondkey msgid "Grab second key" msgstr "" #: lazarusidestrconsts:srkmpresskey msgid "Please press a key ..." msgstr "" #: lazarusidestrconsts:srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "Alternativní klávesa (nebo kombinace dvou kláves)" #: lazarusidestrconsts:srkmalreadyconnected msgid " The key \"%s\" is already connected to \"%s\"." msgstr " Klíč \"%s\" již je připojen k \"%s\"." #: lazarusidestrconsts:srkmecwordleft msgid "Move cursor word left" msgstr "" #: lazarusidestrconsts:srkmecwordright msgid "Move cursor word right" msgstr "" #: lazarusidestrconsts:srkmeclinestart msgid "Move cursor to line start" msgstr "" #: lazarusidestrconsts:srkmeclineend msgid "Move cursor to line end" msgstr "" #: lazarusidestrconsts:srkmecpageup msgid "Move cursor up one page" msgstr "" #: lazarusidestrconsts:srkmecpagedown msgid "Move cursor down one page" msgstr "" #: lazarusidestrconsts:srkmecpageleft msgid "Move cursor left one page" msgstr "" #: lazarusidestrconsts:srkmecpageright msgid "Move cursor right one page" msgstr "" #: lazarusidestrconsts:srkmecpagetop msgid "Move cursor to top of page" msgstr "" #: lazarusidestrconsts:srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "" #: lazarusidestrconsts:srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "" #: lazarusidestrconsts:srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "" #: lazarusidestrconsts:srkmecgotoxy msgid "Goto XY" msgstr "" #: lazarusidestrconsts:srkmecselleft msgid "SelLeft" msgstr "" #: lazarusidestrconsts:srkmecselright msgid "SelRight" msgstr "" #: lazarusidestrconsts:srkmecselup msgid "Select Up" msgstr "" #: lazarusidestrconsts:srkmecseldown msgid "Select Down" msgstr "" #: lazarusidestrconsts:srkmecselwordleft msgid "Select Word Left" msgstr "" #: lazarusidestrconsts:srkmecselwordright msgid "Select Word Right" msgstr "" #: lazarusidestrconsts:srkmecsellinestart msgid "Select Line Start" msgstr "" #: lazarusidestrconsts:srkmecsellineend msgid "Select Line End" msgstr "" #: lazarusidestrconsts:srkmecselpageup msgid "Select Page Up" msgstr "" #: lazarusidestrconsts:srkmecselpagedown msgid "Select Page Down" msgstr "" #: lazarusidestrconsts:srkmecselpageleft msgid "Select Page Left" msgstr "" #: lazarusidestrconsts:srkmecselpageright msgid "Select Page Right" msgstr "" #: lazarusidestrconsts:srkmecselpagetop msgid "Select Page Top" msgstr "" #: lazarusidestrconsts:srkmecselpagebottom msgid "Select Page Bottom" msgstr "" #: lazarusidestrconsts:srkmecseleditortop msgid "Select to absolute beginning" msgstr "" #: lazarusidestrconsts:srkmecseleditorbottom msgid "Select to absolute end" msgstr "" #: lazarusidestrconsts:srkmecselgotoxy msgid "Select Goto XY" msgstr "" #: lazarusidestrconsts:srkmecselectall msgid "Select All" msgstr "" #: lazarusidestrconsts:srkmecdeletelastchar msgid "Delete Last Char" msgstr "Odstratni poslední znak" #: lazarusidestrconsts:srkmecdeletechar msgid "Delete char at cursor" msgstr "Odstranit znak na pozici kurzoru" #: lazarusidestrconsts:srkmecdeleteword msgid "Delete to end of word" msgstr "Odstranit ke konci slova" #: lazarusidestrconsts:srkmecdeletelastword msgid "Delete to start of word" msgstr "Odstranit k začátku slova" #: lazarusidestrconsts:srkmecdeletebol msgid "Delete to beginning of line" msgstr "Odstranit k začátek řádku" #: lazarusidestrconsts:srkmecdeleteeol msgid "Delete to end of line" msgstr "Smazat ke konci řádku" #: lazarusidestrconsts:srkmecdeleteline msgid "Delete current line" msgstr "Odstranit aktuální řádek" #: lazarusidestrconsts:srkmecclearall msgid "Delete whole text" msgstr "Odstranit celý text" #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" msgstr "Ukončit řádek a přesunout kurzor" #: lazarusidestrconsts:srkmecinsertline msgid "Break line, leave cursor" msgstr "Ukončit řádek a nechat kurzor" #: lazarusidestrconsts:srkmecchar msgid "Char" msgstr "" #: lazarusidestrconsts:srkmecimestr msgid "Ime Str" msgstr "" #: lazarusidestrconsts:srkmeccut msgid "Cut selection to clipboard" msgstr "" #: lazarusidestrconsts:srkmeccopy msgid "Copy selection to clipboard" msgstr "" #: lazarusidestrconsts:srkmecpaste msgid "Paste clipboard to current position" msgstr "" #: lazarusidestrconsts:srkmecscrollup msgid "Scroll up one line" msgstr "" #: lazarusidestrconsts:srkmecscrolldown msgid "Scroll down one line" msgstr "" #: lazarusidestrconsts:srkmecscrollleft msgid "Scroll left one char" msgstr "" #: lazarusidestrconsts:srkmecscrollright msgid "Scroll right one char" msgstr "" #: lazarusidestrconsts:srkmecinsertmode msgid "Insert Mode" msgstr "" #: lazarusidestrconsts:srkmecoverwritemode msgid "Overwrite Mode" msgstr "" #: lazarusidestrconsts:srkmectogglemode msgid "Toggle Mode" msgstr "" #: lazarusidestrconsts:srkmecblockindent msgid "Indent block" msgstr "" #: lazarusidestrconsts:srkmecblockunindent msgid "Unindent block" msgstr "" #: lazarusidestrconsts:srkmecshifttab msgid "Shift Tab" msgstr "" #: lazarusidestrconsts:srkmecmatchbracket msgid "Go to matching bracket" msgstr "" #: lazarusidestrconsts:srkmecnormalselect msgid "Normal selection mode" msgstr "" #: lazarusidestrconsts:srkmeccolumnselect msgid "Column selection mode" msgstr "" #: lazarusidestrconsts:srkmeclineselect msgid "Line selection mode" msgstr "" #: lazarusidestrconsts:srkmecautocompletion msgid "Code template completion" msgstr "" #: lazarusidestrconsts:srkmecuserfirst msgid "User First" msgstr "" #: lazarusidestrconsts:srkmecsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts:srkmecprevbookmark msgid "Previous Bookmark" msgstr "Předchozí značka" #: lazarusidestrconsts:srkmecnextbookmark msgid "Next Bookmark" msgstr "Další značka" #: lazarusidestrconsts:liskmgotomarker0 msgid "Go to marker 0" msgstr "" #: lazarusidestrconsts:liskmgotomarker1 msgid "Go to marker 1" msgstr "" #: lazarusidestrconsts:liskmgotomarker2 msgid "Go to marker 2" msgstr "" #: lazarusidestrconsts:liskmgotomarker3 msgid "Go to marker 3" msgstr "" #: lazarusidestrconsts:liskmgotomarker4 msgid "Go to marker 4" msgstr "" #: lazarusidestrconsts:liskmgotomarker5 msgid "Go to marker 5" msgstr "" #: lazarusidestrconsts:liskmgotomarker6 msgid "Go to marker 6" msgstr "" #: lazarusidestrconsts:liskmgotomarker7 msgid "Go to marker 7" msgstr "" #: lazarusidestrconsts:liskmgotomarker8 msgid "Go to marker 8" msgstr "" #: lazarusidestrconsts:liskmgotomarker9 msgid "Go to marker 9" msgstr "" #: lazarusidestrconsts:liskmsetmarker0 msgid "Set marker 0" msgstr "" #: lazarusidestrconsts:liskmsetmarker1 msgid "Set marker 1" msgstr "" #: lazarusidestrconsts:liskmsetmarker2 msgid "Set marker 2" msgstr "" #: lazarusidestrconsts:liskmsetmarker3 msgid "Set marker 3" msgstr "" #: lazarusidestrconsts:liskmsetmarker4 msgid "Set marker 4" msgstr "" #: lazarusidestrconsts:liskmsetmarker5 msgid "Set marker 5" msgstr "" #: lazarusidestrconsts:liskmsetmarker6 msgid "Set marker 6" msgstr "" #: lazarusidestrconsts:liskmsetmarker7 msgid "Set marker 7" msgstr "" #: lazarusidestrconsts:liskmsetmarker8 msgid "Set marker 8" msgstr "" #: lazarusidestrconsts:liskmsetmarker9 msgid "Set marker 9" msgstr "" #: lazarusidestrconsts:srkmecgotomarker msgid "Go to Marker %d" msgstr "" #: lazarusidestrconsts:srkmecsetmarker msgid "Set Marker %d" msgstr "" #: lazarusidestrconsts:srkmecjumptoeditor msgid "Focus to source editor" msgstr "" #: lazarusidestrconsts:liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "" #: lazarusidestrconsts:srkmecnexteditor msgid "Go to next editor" msgstr "" #: lazarusidestrconsts:srkmecpreveditor msgid "Go to prior editor" msgstr "" #: lazarusidestrconsts:liskmaddbreakpoint msgid "Add break point" msgstr "Přidat bod přerušení" #: lazarusidestrconsts:liskmremovebreakpoint msgid "Remove break point" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorleft msgid "Move editor left" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorright msgid "Move editor right" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "" #: lazarusidestrconsts:srkmecgotoeditor msgid "Go to editor %d" msgstr "" #: lazarusidestrconsts:srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Převést ve výběru tabulátory na mezery " #: lazarusidestrconsts:liskmencloseselection msgid "Enclose selection" msgstr "" #: lazarusidestrconsts:srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "" #: lazarusidestrconsts:srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "" #: lazarusidestrconsts:srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "" #: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts:liskminsertusername msgid "Insert username" msgstr "" #: lazarusidestrconsts:liskminsertdateandtime msgid "Insert date and time" msgstr "" #: lazarusidestrconsts:srkmecinsertusername msgid "Insert current username" msgstr "" #: lazarusidestrconsts:srkmecinsertdatetime msgid "Insert current date and time" msgstr "" #: lazarusidestrconsts:srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "" #: lazarusidestrconsts:srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "" #: lazarusidestrconsts:srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "" #: lazarusidestrconsts:srkmecfind msgid "Find text" msgstr "" #: lazarusidestrconsts:srkmecfindnext msgid "Find next" msgstr "" #: lazarusidestrconsts:srkmecfindprevious msgid "Find previous" msgstr "" #: lazarusidestrconsts:srkmecfindinfiles msgid "Find in files" msgstr "" #: lazarusidestrconsts:srkmecreplace msgid "Replace text" msgstr "" #: lazarusidestrconsts:liskmfindincremental msgid "Find incremental" msgstr "" #: lazarusidestrconsts:srkmecfindproceduredefinition msgid "Find procedure definiton" msgstr "" #: lazarusidestrconsts:srkmecfindproceduremethod msgid "Find procedure method" msgstr "" #: lazarusidestrconsts:srkmecgotolinenumber msgid "Go to line number" msgstr "" #: lazarusidestrconsts:srkmecfindnextwordoccurrence msgid "Find next word occurrence" msgstr "" #: lazarusidestrconsts:srkmecfindprevwordoccurrence msgid "Find previous word occurrence" msgstr "" #: lazarusidestrconsts:srkmecaddjumppoint msgid "Add jump point" msgstr "Přidat bod skoku" #: lazarusidestrconsts:liskmviewjumphistory msgid "View jump history" msgstr "" #: lazarusidestrconsts:srkmecopenfileatcursor msgid "Open file at cursor" msgstr "" #: lazarusidestrconsts:srkmecgotoincludedirective msgid "Go to to include directive of current include file" msgstr "" #: lazarusidestrconsts:srkmecprocedurelist msgid "Procedure List ..." msgstr "" #: lazarusidestrconsts:srkmectoggleformunit msgid "Switch between form and unit" msgstr "" #: lazarusidestrconsts:srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "" #: lazarusidestrconsts:srkmectogglesourceeditor msgid "View Source Editor" msgstr "" #: lazarusidestrconsts:srkmectogglecodeexpl msgid "View Code Explorer" msgstr "" #: lazarusidestrconsts:srkmectogglelazdoc msgid "View Documentation Editor" msgstr "" #: lazarusidestrconsts:srkmectogglemessages msgid "View messages" msgstr "" #: lazarusidestrconsts:srkmectogglesearchresults msgid "View Search Results" msgstr "" #: lazarusidestrconsts:srkmectogglewatches msgid "View watches" msgstr "" #: lazarusidestrconsts:srkmectogglebreakpoints msgid "View breakpoints" msgstr "" #: lazarusidestrconsts:srkmectoggledebuggerout msgid "View debugger output" msgstr "" #: lazarusidestrconsts:srkmectogglelocals msgid "View local variables" msgstr "" #: lazarusidestrconsts:srkmectogglecallstack msgid "View call stack" msgstr "" #: lazarusidestrconsts:srkmecviewunits msgid "View units" msgstr "" #: lazarusidestrconsts:srkmecviewforms msgid "View forms" msgstr "" #: lazarusidestrconsts:srkmecviewunitdependencies msgid "View unit dependencies" msgstr "" #: lazarusidestrconsts:srkmecviewunitinfo msgid "View unit information" msgstr "" #: lazarusidestrconsts:srkmecviewanchoreditor msgid "View anchor editor" msgstr "" #: lazarusidestrconsts:srkmectogglecodebrowser msgid "View code browser" msgstr "" #: lazarusidestrconsts:srkmectogglecomppalette msgid "View component palette" msgstr "" #: lazarusidestrconsts:srkmectoggleidespeedbtns msgid "View IDE speed buttons" msgstr "" #: lazarusidestrconsts:srkmecwordcompletion msgid "Word completion" msgstr "Doplnění slova" #: lazarusidestrconsts:srkmeccompletecode msgid "Complete code" msgstr "Dokončení kódu" #: lazarusidestrconsts:srkmecshowcodecontext msgid "Show code context" msgstr "" #: lazarusidestrconsts:srkmecextractproc msgid "Extract procedure" msgstr "" #: lazarusidestrconsts:srkmecfindidentifierrefs msgid "Find identifier references" msgstr "" #: lazarusidestrconsts:srkmecrenameidentifier msgid "Rename identifier" msgstr "" #: lazarusidestrconsts:srkmecinvertassignment msgid "Invert assignment" msgstr "" #: lazarusidestrconsts:srkmecsyntaxcheck msgid "Syntax check" msgstr "" #: lazarusidestrconsts:srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" msgstr "" #: lazarusidestrconsts:srkmecfinddeclaration msgid "Find declaration" msgstr "" #: lazarusidestrconsts:srkmecfindblockotherend msgid "Find block other end" msgstr "" #: lazarusidestrconsts:srkmecfindblockstart msgid "Find block start" msgstr "" #: lazarusidestrconsts:srkmecbuild msgid "build program/project" msgstr "Sestavit program/projekt" #: lazarusidestrconsts:srkmecbuildall msgid "build all files of program/project" msgstr "sestavit všechny soubory programu/projektu" #: lazarusidestrconsts:srkmecquickcompile msgid "quick compile, no linking" msgstr "" #: lazarusidestrconsts:srkmecabortbuild msgid "abort build" msgstr "přerušit sestavení" #: lazarusidestrconsts:srkmecrun msgid "run program" msgstr "" #: lazarusidestrconsts:srkmecpause msgid "pause program" msgstr "" #: lazarusidestrconsts:srkmecstopprogram msgid "stop program" msgstr "" #: lazarusidestrconsts:srkmecresetdebugger msgid "reset debugger" msgstr "" #: lazarusidestrconsts:srkmecaddbreakpoint msgid "add break point" msgstr "přidat bod přerušení" #: lazarusidestrconsts:srkmecremovebreakpoint msgid "remove break point" msgstr "" #: lazarusidestrconsts:srkmecrunparameters msgid "run parameters" msgstr "" #: lazarusidestrconsts:srkmeccompileroptions msgid "compiler options" msgstr "volby překladače" #: lazarusidestrconsts:srkmecbuildfile msgid "build file" msgstr "sestavit soubor" #: lazarusidestrconsts:srkmecrunfile msgid "run file" msgstr "" #: lazarusidestrconsts:srkmecconfigbuildfile msgid "config build file" msgstr "konfigurační soubor sestavení" #: lazarusidestrconsts:srkmecinspect msgid "inspect" msgstr "" #: lazarusidestrconsts:srkmecevaluate msgid "evaluate/modify" msgstr "" #: lazarusidestrconsts:srkmecaddwatch msgid "add watch" msgstr "přidat sledování" #: lazarusidestrconsts:srkmecexttoolsettings msgid "External tools settings" msgstr "" #: lazarusidestrconsts:srkmecbuildlazarus msgid "Build lazarus" msgstr "Sestavit lazarus" #: lazarusidestrconsts:srkmecexttool msgid "External tool %d" msgstr "" #: lazarusidestrconsts:srkmeccustomtool msgid "Custom tool %d" msgstr "" #: lazarusidestrconsts:srkmecenvironmentoptions msgid "General environment options" msgstr "" #: lazarusidestrconsts:liskmeditoroptions msgid "Editor options" msgstr "Nastavení editoru" #: lazarusidestrconsts:liskmeditcodetemplates msgid "Edit Code Templates" msgstr "Upravit šablony kódů" #: lazarusidestrconsts:liskmcodetoolsoptions msgid "CodeTools options" msgstr "" #: lazarusidestrconsts:liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "" #: lazarusidestrconsts:srkmeccodetoolsoptions msgid "Codetools options" msgstr "" #: lazarusidestrconsts:srkmeccodetoolsdefinesed msgid "Codetools defines editor" msgstr "" #: lazarusidestrconsts:lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" msgstr "" #: lazarusidestrconsts:srkmecmakeresourcestring msgid "Make resource string" msgstr "" #: lazarusidestrconsts:liskmdiffeditorfiles msgid "Diff editor files" msgstr "Rozdíl editovaných souborů" #: lazarusidestrconsts:liskmconvertdfmfiletolfm msgid "Convert DFM file to LFM" msgstr "Převést DFM soubor na LFM" #: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit msgid "Convert Delphi unit to Lazarus unit" msgstr "Převést Delphi jednotku na Lazarus jednotku" #: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi project to Lazarus project" msgstr "Převést Delphi projekt na Lazarus projekt" #: lazarusidestrconsts:srkmecdiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts:srkmecunknown msgid "unknown editor command" msgstr "neznámý příkaz editoru" #: lazarusidestrconsts:srvk_unknown msgid "Unknown" msgstr "Neznámý" #: lazarusidestrconsts:srvk_lbutton msgid "Mouse Button Left" msgstr "Levé tlačítko myši" #: lazarusidestrconsts:srvk_rbutton msgid "Mouse Button Right" msgstr "Pravé tlačítko myši" #: lazarusidestrconsts:srvk_mbutton msgid "Mouse Button Middle" msgstr "Prostřední tlačítko myši" #: lazarusidestrconsts:srvk_back msgid "Backspace" msgstr "Klávesa zpět" #: lazarusidestrconsts:srvk_tab msgid "Tab" msgstr "" #: lazarusidestrconsts:srvk_clear msgid "Clear" msgstr "" #: lazarusidestrconsts:srvk_return msgid "Return" msgstr "" #: lazarusidestrconsts:srvk_shift msgid "Shift" msgstr "" #: lazarusidestrconsts:srvk_control msgid "Control" msgstr "" #: lazarusidestrconsts:srvk_menu msgid "Menu" msgstr "Menu" #: lazarusidestrconsts:srvk_pause msgid "Pause key" msgstr "" #: lazarusidestrconsts:srvk_capital msgid "Capital" msgstr "" #: lazarusidestrconsts:srvk_kana msgid "Kana" msgstr "" #: lazarusidestrconsts:srvk_junja msgid "Junja" msgstr "" #: lazarusidestrconsts:srvk_final msgid "Final" msgstr "" #: lazarusidestrconsts:srvk_hanja msgid "Hanja" msgstr "" #: lazarusidestrconsts:srvk_escape msgid "Escape" msgstr "" #: lazarusidestrconsts:srvk_convert msgid "Convert" msgstr "Převést" #: lazarusidestrconsts:srvk_nonconvert msgid "Nonconvert" msgstr "" #: lazarusidestrconsts:srvk_accept msgid "Accept" msgstr "Přijmout" #: lazarusidestrconsts:srvk_modechange msgid "Mode Change" msgstr "Změna módu" #: lazarusidestrconsts:srvk_space msgid "Space key" msgstr "" #: lazarusidestrconsts:srvk_prior msgid "Prior" msgstr "" #: lazarusidestrconsts:srvk_next msgid "Next" msgstr "Další" #: lazarusidestrconsts:srvk_end msgid "End" msgstr "" #: lazarusidestrconsts:srvk_home msgid "Home" msgstr "" #: lazarusidestrconsts:srvk_left msgid "Left" msgstr "" #: lazarusidestrconsts:srvk_up msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts:srvk_right msgid "Right" msgstr "" #: lazarusidestrconsts:srvk_print msgid "Print" msgstr "Tisk" #: lazarusidestrconsts:srvk_execute msgid "Execute" msgstr "" #: lazarusidestrconsts:srvk_snapshot msgid "Snapshot" msgstr "" #: lazarusidestrconsts:srvk_insert msgid "Insert" msgstr "" #: lazarusidestrconsts:srvk_help msgid "Help" msgstr "" #: lazarusidestrconsts:srvk_lwin msgid "left windows key" msgstr "" #: lazarusidestrconsts:srvk_rwin msgid "right windows key" msgstr "" #: lazarusidestrconsts:srvk_apps msgid "application key" msgstr "aplikační klávesa" #: lazarusidestrconsts:srvk_numpad msgid "Numpad %d" msgstr "" #: lazarusidestrconsts:srvk_numlock msgid "Numlock" msgstr "" #: lazarusidestrconsts:srvk_scroll msgid "Scroll" msgstr "" #: lazarusidestrconsts:srvk_irregular msgid "Irregular " msgstr "" #: lazarusidestrconsts:srkm_alt msgid "Alt" msgstr "Alt" #: lazarusidestrconsts:srkm_ctrl msgid "Ctrl" msgstr "" #: lazarusidestrconsts:srkmcatcursormoving msgid "Cursor moving commands" msgstr "" #: lazarusidestrconsts:srkmcatselection msgid "Text selection commands" msgstr "Příkazy výběru textu" #: lazarusidestrconsts:srkmcatediting msgid "Text editing commands" msgstr "Příkazy editace textu" #: lazarusidestrconsts:liskmdeletelastchar msgid "Delete last char" msgstr "Odstranit poslední znak" #: lazarusidestrconsts:srkmcatcmdcmd msgid "Command commands" msgstr "" #: lazarusidestrconsts:srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Příkazy hledání a nahrazení textu" #: lazarusidestrconsts:srkmcatmarker msgid "Text marker commands" msgstr "Příkazy označení textu" #: lazarusidestrconsts:liskmsetfreebookmark msgid "Set free Bookmark" msgstr "" #: lazarusidestrconsts:srkmcatcodetools msgid "CodeTools commands" msgstr "" #: lazarusidestrconsts:srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "" #: lazarusidestrconsts:srkmcatfilemenu msgid "File menu commands" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "" #: lazarusidestrconsts:srkmcatviewmenu msgid "View menu commands" msgstr "" #: lazarusidestrconsts:liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "" #: lazarusidestrconsts:liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "" #: lazarusidestrconsts:liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "" #: lazarusidestrconsts:liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "" #: lazarusidestrconsts:liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "" #: lazarusidestrconsts:liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "" #: lazarusidestrconsts:liskmtoggleviewwatches msgid "Toggle view Watches" msgstr "" #: lazarusidestrconsts:liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" msgstr "" #: lazarusidestrconsts:liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" msgstr "" #: lazarusidestrconsts:liskmtoggleviewcallstack msgid "Toggle view Call Stack" msgstr "" #: lazarusidestrconsts:liskmtoggleviewdebuggeroutput msgid "Toggle view Debugger Output" msgstr "" #: lazarusidestrconsts:srkmcatprojectmenu msgid "Project menu commands" msgstr "" #: lazarusidestrconsts:liskmnewproject msgid "New project" msgstr "Nový projekt" #: lazarusidestrconsts:liskmnewprojectfromfile msgid "New project from file" msgstr "Nový projekt ze souboru" #: lazarusidestrconsts:liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "" #: lazarusidestrconsts:srkmcatrunmenu msgid "Run menu commands" msgstr "" #: lazarusidestrconsts:liskmbuildprojectprogram msgid "Build project/program" msgstr "Sestavit projekt/program" #: lazarusidestrconsts:liskmbuildallfilesofprojectprogram msgid "Build all files of project/program" msgstr "Sestavit všechny soubory projektu/programu" #: lazarusidestrconsts:liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "" #: lazarusidestrconsts:liskmabortbuilding msgid "Abort building" msgstr "Přerušit sestavování" #: lazarusidestrconsts:liskmrunprogram msgid "Run program" msgstr "" #: lazarusidestrconsts:liskmpauseprogram msgid "Pause program" msgstr "" #: lazarusidestrconsts:liskmviewprojectoptions msgid "View project options" msgstr "" #: lazarusidestrconsts:srkmcatcomponentsmenu msgid "Components menu commands" msgstr "Povely menu komponenty" #: lazarusidestrconsts:srkmcattoolmenu msgid "Tools menu commands" msgstr "" #: lazarusidestrconsts:liskmexternaltoolssettings msgid "External Tools settings" msgstr "" #: lazarusidestrconsts:srkmcatenvmenu msgid "Environment menu commands" msgstr "" #: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "Převést Delphi balíček na Lazarus balíček" #: lazarusidestrconsts:srkmcarhelpmenu msgid "Help menu commands" msgstr "" #: lazarusidestrconsts:liskeycatdesigner msgid "Designer commands" msgstr "Povely návrháře" #: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard msgid "Copy selected Components to clipboard" msgstr "" #: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard msgid "Cut selected Components to clipboard" msgstr "" #: lazarusidestrconsts:liskmpastecomponentsfromclipboard msgid "Paste Components from clipboard" msgstr "" #: lazarusidestrconsts:liskeycatobjinspector msgid "Object Inspector commands" msgstr "" #: lazarusidestrconsts:liskeycatcustom msgid "Custom commands" msgstr "" #: lazarusidestrconsts:rslanguageautomatic msgid "Automatic (or english)" msgstr "Automaticky (nebo angličtina)" #: lazarusidestrconsts:rslanguageenglish msgid "English" msgstr "" #: lazarusidestrconsts:rslanguagegerman msgid "German" msgstr "" #: lazarusidestrconsts:rslanguagespanish msgid "Spanish" msgstr "" #: lazarusidestrconsts:rslanguagefrench msgid "French" msgstr "" #: lazarusidestrconsts:rslanguagerussian msgid "Russian" msgstr "" #: lazarusidestrconsts:rslanguagepolish msgid "Polish" msgstr "" #: lazarusidestrconsts:rslanguagepolishiso msgid "Polish(ISO 8859-2)" msgstr "" #: lazarusidestrconsts:rslanguagepolishwin msgid "Polish(CP1250)" msgstr "" #: lazarusidestrconsts:rslanguageitalian msgid "Italian" msgstr "" #: lazarusidestrconsts:rslanguagecatalan msgid "Catalan" msgstr "" #: lazarusidestrconsts:rslanguagefinnish msgid "Finnish" msgstr "" #: lazarusidestrconsts:rslanguagehebrew msgid "Hebrew" msgstr "" #: lazarusidestrconsts:rslanguagearabic msgid "Arabic" msgstr "Arabština" #: lazarusidestrconsts:rslanguageportugues msgid "Portuguese" msgstr "" #: lazarusidestrconsts:rslanguageukrainian msgid "Ukrainian" msgstr "" #: lazarusidestrconsts:rslanguagedutch msgid "Dutch" msgstr "Němčina" #: lazarusidestrconsts:rslanguagejapanese msgid "Japanese" msgstr "" #: lazarusidestrconsts:rslanguagechinese msgid "Chinese" msgstr "" #: lazarusidestrconsts:rslanguageindonesian msgid "Indonesian" msgstr "" #: lazarusidestrconsts:rslanguageafrikaans msgid "Afrikaans" msgstr "Afrikánština" #: lazarusidestrconsts:rslanguagelithuanian msgid "Lithuanian" msgstr "" #: lazarusidestrconsts:dlgunitdepcaption msgid "Unit dependencies" msgstr "" #: lazarusidestrconsts:dlgunitdepbrowse msgid "Open" msgstr "" #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "" #: lazarusidestrconsts:listodogoto msgid "Goto" msgstr "" #: lazarusidestrconsts:lisdocumentationeditor msgid "Documentation Editor" msgstr "Editor dokumentace" #: lazarusidestrconsts:lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" msgstr "Chcete znovu sestavit Lazarus?" #: lazarusidestrconsts:liscleanlazarussource msgid "Clean Lazarus Source" msgstr "" #: lazarusidestrconsts:lismakenotfound msgid "Make not found" msgstr "" #: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" msgstr "" #: lazarusidestrconsts:liscompileidewithoutlinking msgid "Compile IDE (without linking)" msgstr "" #: lazarusidestrconsts:lislcl msgid "LCL" msgstr "" #: lazarusidestrconsts:liscomponent msgid "Component" msgstr "Komponenta" #: lazarusidestrconsts:liscodetools msgid "CodeTools" msgstr "" #: lazarusidestrconsts:lissynedit msgid "SynEdit" msgstr "" #: lazarusidestrconsts:lisideintf msgid "IDE Interface" msgstr "" #: lazarusidestrconsts:lisjitform msgid "JIT Form" msgstr "" #: lazarusidestrconsts:lispkgreg msgid "Package Registration" msgstr "" #: lazarusidestrconsts:liside msgid "IDE" msgstr "" #: lazarusidestrconsts:lisstarter msgid "Starter" msgstr "" #: lazarusidestrconsts:lisexamples msgid "Examples" msgstr "" #: lazarusidestrconsts:lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" msgstr "Nastavení %sSestavení Lazarusu%s" #: lazarusidestrconsts:lislazbuildcleanall msgid "Clean all" msgstr "" #: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools msgid "Build Components (SynEdit, CodeTools)" msgstr "Sestavit komponenty (SynEdit, CodeTools)" #: lazarusidestrconsts:lislazbuildbuildsynedit msgid "Build SynEdit" msgstr "Sestavit SynEdit" #: lazarusidestrconsts:lislazbuildbuildcodetools msgid "Build CodeTools" msgstr "Sestavit kódové nástroje" #: lazarusidestrconsts:lislazbuildbuildide msgid "Build IDE" msgstr "Sestavit IDE" #: lazarusidestrconsts:lislazbuildbuildexamples msgid "Build Examples" msgstr "Sestavit příklady" #: lazarusidestrconsts:lislazbuildoptions msgid "Options:" msgstr "" #: lazarusidestrconsts:lislazbuildtargetos msgid "Target OS:" msgstr "" #: lazarusidestrconsts:lislazbuildtargetcpu msgid "Target CPU:" msgstr "" #: lazarusidestrconsts:lislazbuildtargetdirectory msgid "Target Directory:" msgstr "" #: lazarusidestrconsts:lislazbuildlclinterface msgid "LCL interface" msgstr "" #: lazarusidestrconsts:lislazbuildbuildjitform msgid "Build JITForm" msgstr "Sestavit JITForm" #: lazarusidestrconsts:lislazbuildwithstaticpackages msgid "With Packages" msgstr "S balíčky" #: lazarusidestrconsts:lislazbuildrestartafterbuild msgid "Restart After Successfull Build" msgstr "" #: lazarusidestrconsts:lislazbuildconfirmbuild msgid "Confirm Before ReBuild Lazarus" msgstr "" #: lazarusidestrconsts:lislazbuildok msgid "Ok" msgstr "" #: lazarusidestrconsts:lisctdtemplates msgid "Templates" msgstr "" #: lazarusidestrconsts:lissavesettings msgid "Save Settings" msgstr "" #: lazarusidestrconsts:lislazbuildcancel msgid "Cancel" msgstr "" #: lazarusidestrconsts:lislazbuildnone msgid "None" msgstr "" #: lazarusidestrconsts:lislazbuildbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:lislazbuildcleanbuild msgid "Clean+Build" msgstr "" #: lazarusidestrconsts:lislazbuildbuildoptions msgid "Build Options" msgstr "Volby sestavení" #: lazarusidestrconsts:lislazbuildquickbuildoptions msgid "Quick Build Options" msgstr "" #: lazarusidestrconsts:lislazbuildadvancedbuildoptions msgid "Advanced Build Options" msgstr "Pokročilé volby sestavení" #: lazarusidestrconsts:liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" msgstr "" #: lazarusidestrconsts:listcompilerinternalerror msgid "Internal compiler error! (%d)" msgstr "" #: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgstr "" #: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "" #: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsok msgid "Ok" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsnone msgid "None" msgstr "" #: lazarusidestrconsts:liscodetoolsoptskeyword msgid "Keyword" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsidentifier msgid "Identifier" msgstr "" #: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Doplňující soubory k vyhledání (napč. /path/*.pas;/path2/*.pp)" #: lazarusidestrconsts:lisfrifindreferences msgid "Find References" msgstr "" #: lazarusidestrconsts:lisfriinvalididentifier msgid "Invalid Identifier" msgstr "" #: lazarusidestrconsts:lisfrirenameto msgid "Rename to" msgstr "" #: lazarusidestrconsts:lisfrirename msgid "Rename" msgstr "" #: lazarusidestrconsts:lisfrisearchincommentstoo msgid "Search in comments too" msgstr "" #: lazarusidestrconsts:lisfrisearchwhere msgid "Search where" msgstr "" #: lazarusidestrconsts:liscodetoolsoptscolon msgid "Colon" msgstr "" #: lazarusidestrconsts:liscodetoolsoptssemicolon msgid "Semicolon" msgstr "" #: lazarusidestrconsts:liscodetoolsoptscomma msgid "Comma" msgstr "" #: lazarusidestrconsts:liscodetoolsoptspoint msgid "Point" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsat msgid "At" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsnumber msgid "Number" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsstringconst msgid "String constant" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsnewline msgid "Newline" msgstr "Nový řádek" #: lazarusidestrconsts:liscodetoolsoptsspace msgid "Space" msgstr "" #: lazarusidestrconsts:liscodetoolsoptssymbol msgid "Symbol" msgstr "" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" msgstr "" #: lazarusidestrconsts:liscodetoolsdefswriteerror msgid "Write error" msgstr "Chyba zápisu" #: lazarusidestrconsts:lisstopdebugging2 msgid "Stop debugging?" msgstr "" #: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "" #: lazarusidestrconsts:liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsreaderror msgid "Read error" msgstr "" #: lazarusidestrconsts:liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "" #: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." msgstr "" #: lazarusidestrconsts:lislclunitpathmissing msgid "LCL unit path missing" msgstr "" #: lazarusidestrconsts:lisnotadelphiunit msgid "Not a Delphi unit" msgstr "" #: lazarusidestrconsts:listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." msgstr "Soubor %s%s%s není Delphi jednotka." #: lazarusidestrconsts:liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." msgstr "Automaticky generované uzly nelze editovat." #: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "" #: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscompilerpath msgid "compiler path" msgstr "Cesta překladače" #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC SVN source directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal SVN Sources" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal SVN source directory." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdirectory msgid "%s directory" msgstr "%s složka" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 msgid "%s project directory" msgstr "%s složka projektu" #: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsexit msgid "Exit" msgstr "" #: lazarusidestrconsts:liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave msgid "Exit without Save" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts:liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Odstranit uzel" #: lazarusidestrconsts:liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Převést uzel" #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsundefine msgid "Undefine" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsundefineall msgid "Undefine All" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsblock msgid "Block" msgstr "Blok" #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Složka" #: lazarusidestrconsts:liscodetoolsdefsif msgid "If" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsifdef msgid "IfDef" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsifndef msgid "IfNDef" msgstr "" #: lazarusidestrconsts:liscodetoolsdefselseif msgid "ElseIf" msgstr "JinakPokud" #: lazarusidestrconsts:liscodetoolsdefselse msgid "Else" msgstr "Jinak" #: lazarusidestrconsts:lisctdefstools msgid "Tools" msgstr "" #: lazarusidestrconsts:lisctdefsopenpreview msgid "Open Preview" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts:liscodetoolsdefsdescription msgid "Description:" msgstr "Popis:" #: lazarusidestrconsts:liscodetoolsdefsvariable msgid "Variable:" msgstr "Proměnná:" #: lazarusidestrconsts:liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Hodnota jako text" #: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "Hodnota jako cesty souboru" #: lazarusidestrconsts:liscodetoolsdefsaction msgid "Action: %s" msgstr "Akce: %s" #: lazarusidestrconsts:liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "%s, automaticky generováno" #: lazarusidestrconsts:liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "%s, údaje projektu" #: lazarusidestrconsts:liscodetoolsdefsnoneselected msgid "none selected" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "" #: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze negrafické komponenty." #: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůže mít neautomaticky vytvořené uzly potomků." #: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsnewnode msgid "NewNode" msgstr "Nový uzel" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "" #: lazarusidestrconsts:liscodetempladdcodetemplate msgid "Add code template" msgstr "Přidat šablonu kódu" #: lazarusidestrconsts:liscodetempladd msgid "Add" msgstr "Přidat" #: lazarusidestrconsts:liscodetempleditcodetemplate msgid "Edit code template" msgstr "Upravit šablonu kódu" #: lazarusidestrconsts:liscodetemplautocompleteon msgid "Auto complete on ..." msgstr "Automatické dokončení na ..." #: lazarusidestrconsts:liscodetemplchange msgid "Change" msgstr "" #: lazarusidestrconsts:liscodetempltoken msgid "Token:" msgstr "" #: lazarusidestrconsts:liscodetemplcomment msgid "Comment:" msgstr "" #: lazarusidestrconsts:liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " msgstr " Symbol %s%s%s již existuje! " #: lazarusidestrconsts:liscodetemplerror msgid "Error" msgstr "" #: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule." #: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusesthetheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." msgstr "" #: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." msgstr "Nelze načíst třídu komponenty %s%s%s, protože závisí na sobě samé." #: lazarusidestrconsts:liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "" #: lazarusidestrconsts:lisabortwholeloading msgid "Abort whole loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts:lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" msgstr "" #: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts:lismakeresourcestring msgid "Make ResourceString" msgstr "" #: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "" #: lazarusidestrconsts:lismakeresstrpleasechoosearesourstring msgid "Please choose a resourstring section from the list." msgstr "" #: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "" #: lazarusidestrconsts:lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "" #: lazarusidestrconsts:lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "" #: lazarusidestrconsts:lismakeresstrconversionoptions msgid "Conversion Options" msgstr "" #: lazarusidestrconsts:lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "" #: lazarusidestrconsts:lismakeresstridentifierlength msgid "Identifier length:" msgstr "" #: lazarusidestrconsts:lismakeresstrdialogidentifier msgid "Identifier" msgstr "" #: lazarusidestrconsts:lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "" #: lazarusidestrconsts:lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "" #: lazarusidestrconsts:lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "" #: lazarusidestrconsts:lismakeresstrappendtosection msgid "Append to section" msgstr "Doplnit k sekci" #: lazarusidestrconsts:lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "" #: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "" #: lazarusidestrconsts:lismakeresstrsourcepreview msgid "Source preview" msgstr "" #: lazarusidestrconsts:lisnostringconstantfound msgid "No string constant found" msgstr "" #: lazarusidestrconsts:lissuccess msgid "Success" msgstr "" #: lazarusidestrconsts:lisallblockslooksok msgid "All blocks looks ok." msgstr "Všechny bloky vypadají dobře." #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "" #: lazarusidestrconsts:lisdiffdlgtext1 msgid "Text1" msgstr "Text1" #: lazarusidestrconsts:lisdiffdlgonlyselection msgid "Only selection" msgstr "" #: lazarusidestrconsts:lisdiffdlgtext2 msgid "Text2" msgstr "Text2" #: lazarusidestrconsts:lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "" #: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "" #: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "" #: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "" #: lazarusidestrconsts:lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "" #: lazarusidestrconsts:lissave msgid "Save ..." msgstr "" #: lazarusidestrconsts:listodolistcaption msgid "ToDo List" msgstr "" #: lazarusidestrconsts:listodolistrefresh msgid "Refresh todo items" msgstr "" #: lazarusidestrconsts:listodolistgotoline msgid "Goto selected source line" msgstr "" #: lazarusidestrconsts:listodolistprintlist msgid "Print todo items" msgstr "Tisk položek úkolovníku" #: lazarusidestrconsts:listodolistoptions msgid "ToDo options..." msgstr "" #: lazarusidestrconsts:listodoldescription msgid "Description" msgstr "Popis" #: lazarusidestrconsts:lisctinsertmacro msgid "Insert Macro" msgstr "" #: lazarusidestrconsts:listodolfile msgid "File" msgstr "" #: lazarusidestrconsts:listodolline msgid "Line" msgstr "" #: lazarusidestrconsts:lispkgfiletypeunit msgid "Unit" msgstr "" #: lazarusidestrconsts:lispkgfiletypevirtualunit msgid "Virtual Unit" msgstr "Virtuální jednotka" #: lazarusidestrconsts:lispkgfiletypelfm msgid "LFM - Lazarus form text" msgstr "" #: lazarusidestrconsts:lispkgfiletypelrs msgid "LRS - Lazarus resource" msgstr "" #: lazarusidestrconsts:lispkgfiletypeinclude msgid "Include file" msgstr "" #: lazarusidestrconsts:lispkgfiletypetext msgid "Text" msgstr "Text" #: lazarusidestrconsts:lispkgfiletypebinary msgid "Binary" msgstr "Binární" #: lazarusidestrconsts:lisviewprojectunits msgid "View Project Units" msgstr "" #: lazarusidestrconsts:lisinformationaboutunit msgid "Information about %s" msgstr "" #: lazarusidestrconsts:lisuidyes msgid "yes" msgstr "ano" #: lazarusidestrconsts:lisuidno msgid "no" msgstr "ne" #: lazarusidestrconsts:lisuidbytes msgid "%s bytes" msgstr "%s bajtů" #: lazarusidestrconsts:lisuidname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts:lisuidtype msgid "Type:" msgstr "" #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "" #: lazarusidestrconsts:lisuidincludedby msgid "Included by:" msgstr "" #: lazarusidestrconsts:lisuidclear msgid "Clear" msgstr "" #: lazarusidestrconsts:lisuidpathsreadonly msgid "Paths (Read Only)" msgstr "" #: lazarusidestrconsts:lisuidunit msgid "Unit" msgstr "" #: lazarusidestrconsts:lisuidsrc msgid "Src" msgstr "" #: lazarusidestrconsts:lisuidok msgid "Ok" msgstr "" #: lazarusidestrconsts:lisuidsize msgid "Size:" msgstr "" #: lazarusidestrconsts:lisuidlines msgid "Lines:" msgstr "" #: lazarusidestrconsts:lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "" #: lazarusidestrconsts:lisueerrorinregularexpression msgid "Error in regular expression" msgstr "" #: lazarusidestrconsts:lissearchfor msgid "Search For " msgstr "" #: lazarusidestrconsts:lisuenotfound msgid "Not found" msgstr "" #: lazarusidestrconsts:lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "" #: lazarusidestrconsts:lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgstr "" #: lazarusidestrconsts:lisuesearching msgid "Searching: %s" msgstr "" #: lazarusidestrconsts:lisuereadonly msgid "%s/ReadOnly" msgstr "%s/Pouze pro čtení" #: lazarusidestrconsts:lisuegotoline msgid "Goto line :" msgstr "" #: lazarusidestrconsts:listmfunctionextractfileextension msgid "Function: extract file extension" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilepath msgid "Function: extract file path" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilenameextension msgid "Function: extract file name+extension" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilenameonly msgid "Function: extract file name only" msgstr "" #: lazarusidestrconsts:listmfunctionappendpathdelimiter msgid "Function: append path delimiter" msgstr "" #: lazarusidestrconsts:listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" msgstr "" #: lazarusidestrconsts:listmunknownmacro msgid "(unknown macro: %s)" msgstr "(neznámé makro: %s)" #: lazarusidestrconsts:lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "" #: lazarusidestrconsts:lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." msgstr "%s%s%s není platný identifikátor." #: lazarusidestrconsts:lisfriidentifier msgid "Identifier: %s" msgstr "" #: lazarusidestrconsts:lissvuooverridesystemvariable msgid "Override system variable" msgstr "" #: lazarusidestrconsts:lissvuook msgid "Ok" msgstr "" #: lazarusidestrconsts:lissortselsortselection msgid "Sort selection" msgstr "" #: lazarusidestrconsts:lissortselpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts:lissortselascending msgid "Ascending" msgstr "Vzestupný" #: lazarusidestrconsts:lissortseldescending msgid "Descending" msgstr "Sestupný" #: lazarusidestrconsts:lissortseldomain msgid "Domain" msgstr "Doména" #: lazarusidestrconsts:lissortsellines msgid "Lines" msgstr "" #: lazarusidestrconsts:lissortselwords msgid "Words" msgstr "Slova" #: lazarusidestrconsts:lissortselparagraphs msgid "Paragraphs" msgstr "" #: lazarusidestrconsts:lissortseloptions msgid "Options" msgstr "" #: lazarusidestrconsts:lissortselcasesensitive msgid "Case Sensitive" msgstr "" #: lazarusidestrconsts:lissortselignorespace msgid "Ignore Space" msgstr "" #: lazarusidestrconsts:lissortselsort msgid "Accept" msgstr "Přijmout" #: lazarusidestrconsts:lissortselcancel msgid "Cancel" msgstr "" #: lazarusidestrconsts:lispublprojinvalidincludefilter msgid "Invalid Include filter" msgstr "" #: lazarusidestrconsts:lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" msgstr "" #: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlz fix errors first." msgstr "Nelze změnit seznam automaticky vytvářených formulářů v zdrojovém programu. %sOpravte nejdřív chybu." #: lazarusidestrconsts:lisprojoptserror msgid "Error" msgstr "" #: lazarusidestrconsts:lispatheditselectdirectory msgid "Select directory" msgstr "" #: lazarusidestrconsts:lispatheditsearchpaths msgid "Search paths:" msgstr "" #: lazarusidestrconsts:lispatheditmovepathdown msgid "Move path down" msgstr "" #: lazarusidestrconsts:lispatheditmovepathup msgid "Move path up" msgstr "" #: lazarusidestrconsts:lispatheditbrowse msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts:lispatheditpathtemplates msgid "Path templates" msgstr "" #: lazarusidestrconsts:lisnewdlgnoitemselected msgid "No item selected" msgstr "" #: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." msgstr "Vytvořit nový editovaný soubor.%sVyberte typ." #: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "" #: lazarusidestrconsts:lispackage msgid "Package" msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Vytvořit novou pascalovskou jednotku." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Vytvořit prázdný textový soubor." #: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." msgstr "Soubor jednoduchého pascalovkého programu.%sLze jej použit pro rychlé a špinavé testování.%sLepší je vytvořit nový projekt." #: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou grafickou aplikaci.%sSoubor programu je spravován Lazarusem." #: lazarusidestrconsts:lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram msgid "Create a new program." msgstr "Vytvořit nový program." #: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou cgi aplikaci.%sProgramový soubor je spravován Lazarusem." #: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "" #: lazarusidestrconsts:lisunabletocreatefile msgid "Unable to create file" msgstr "" #: lazarusidestrconsts:liscannotcreatefile msgid "Can not create file %s%s%s" msgstr "" #: lazarusidestrconsts:lisextendunitpath msgid "Extend unit path?" msgstr "" #: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgstr "" #: lazarusidestrconsts:lisunabletocreatefilename msgid "Unable to create file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletowritefile msgid "Unable to write file" msgstr "" #: lazarusidestrconsts:lisunabletowritefile2 msgid "Unable to write file %s%s%s" msgstr "" #: lazarusidestrconsts:lisfileisnotwritable msgid "File is not writable" msgstr "" #: lazarusidestrconsts:lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletowritefilename msgid "Unable to write file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletoreadfile msgid "Unable to read file" msgstr "Nelze přečíst soubor" #: lazarusidestrconsts:lisunabletoreadfilename msgid "Unable to read file %s%s%s." msgstr "" #: lazarusidestrconsts:liserrordeletingfile msgid "Error deleting file" msgstr "" #: lazarusidestrconsts:lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" msgstr "" #: lazarusidestrconsts:liserrorrenamingfile msgid "Error renaming file" msgstr "" #: lazarusidestrconsts:lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgstr "" #: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgstr "Varování: nejednoznačný soubor nalezen: %s%s%s. Zdrojový soubor je: %s%s%" #: lazarusidestrconsts:lisambiguousfilefound msgid "Ambiguous file found" msgstr "Nalezen nejasný soubor" #: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts:lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "" #: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts:lisprojaddinvalidpackagename msgid "Invalid packagename" msgstr "" #: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgstr "" #: lazarusidestrconsts:lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Závislost již existuje" #: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddpackagenotfound msgid "Package not found" msgstr "" #: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "" #: lazarusidestrconsts:lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisprojaddinvalidversion msgid "Invalid version" msgstr "" #: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" msgstr "" #: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "" #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts:lisprojaddnewrequirement msgid "New Requirement" msgstr "Nové požadavky" #: lazarusidestrconsts:lisprojaddfiles msgid "Add files" msgstr "Přidat soubory" #: lazarusidestrconsts:lisprojaddeditorfile msgid "Add editor files" msgstr "Přidat editované soubory" #: lazarusidestrconsts:lisprojaddaddfiletoproject msgid "Add file to project:" msgstr "Přidat soubor do projektu:" #: lazarusidestrconsts:lisprojaddpackagename msgid "Package Name:" msgstr "" #: lazarusidestrconsts:lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Minimální verze (nepovinný):" #: lazarusidestrconsts:lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "" #: lazarusidestrconsts:liscomppalopenpackage msgid "Open package" msgstr "" #: lazarusidestrconsts:liskmopenpackagefile msgid "Open package file" msgstr "" #: lazarusidestrconsts:liscpopenpackage msgid "Open Package %s" msgstr "" #: lazarusidestrconsts:liscpopenunit msgid "Open Unit %s" msgstr "" #: lazarusidestrconsts:liscomppalopenunit msgid "Open unit" msgstr "" #: lazarusidestrconsts:liscomppalfindcomponent msgid "Find component" msgstr "" #: lazarusidestrconsts:lismacropromptenterdata msgid "Enter data" msgstr "" #: lazarusidestrconsts:lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "" #: lazarusidestrconsts:lisdebuggererror msgid "Debugger error" msgstr "" #: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgstr "" #: lazarusidestrconsts:lisexecutionstopped msgid "Execution stopped" msgstr "" #: lazarusidestrconsts:lisexecutionstoppedon msgid "Execution stopped%s" msgstr "" #: lazarusidestrconsts:lisexecutionpaused msgid "Execution paused" msgstr "" #: lazarusidestrconsts:lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" msgstr "" #: lazarusidestrconsts:lisfilenotfound msgid "File not found" msgstr "" #: lazarusidestrconsts:liscleanupunitpath msgid "Clean up unit path?" msgstr "" #: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgstr "" #: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgstr "" #: lazarusidestrconsts:lisruntofailed msgid "Run-to failed" msgstr "" #: lazarusidestrconsts:lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "Nebyl učený ladící nástroj" #: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgstr "" #: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "" #: lazarusidestrconsts:lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "" #: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists msgid "The launching Application Bundle %s%s%s%sdoes not exist or is not executable.%s%sSee Project -> Project options -> Application." msgstr "" #: lazarusidestrconsts:lisdebuggerinvalid msgid "Debugger invalid" msgstr "" #: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" msgstr "" #: lazarusidestrconsts:lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "" #: lazarusidestrconsts:lisdiskdifferrorreadingfile msgid "Error reading file: %s" msgstr "" #: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "" #: lazarusidestrconsts:lisdiskdiffchangedfiles msgid "Changed files:" msgstr "" #: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "" #: lazarusidestrconsts:lisdiskdiffrevertall msgid "Reload from disk" msgstr "" #: lazarusidestrconsts:lisdiskdiffignorediskchanges msgid "Ignore disk changes" msgstr "" #: lazarusidestrconsts:lisedtdefcurrentproject msgid "Current Project" msgstr "" #: lazarusidestrconsts:lisedtdefcurrentprojectdirectory msgid "Current Project Directory" msgstr "" #: lazarusidestrconsts:lisedtdefprojectsrcpath msgid "Project SrcPath" msgstr "" #: lazarusidestrconsts:lisedtdefprojectincpath msgid "Project IncPath" msgstr "" #: lazarusidestrconsts:lisedtdefprojectunitpath msgid "Project UnitPath" msgstr "" #: lazarusidestrconsts:lisedtdefallpackages msgid "All packages" msgstr "Všechny balíčky" #: lazarusidestrconsts:lisedtdefsallprojects msgid "All projects" msgstr "Všechny projekty" #: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" msgstr "" #: lazarusidestrconsts:lisedtdefsetiocheckson msgid "set IOCHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefsetrangecheckson msgid "set RANGECHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefuselineinfounit msgid "use LineInfo unit" msgstr "použít jednotku LineInfo" #: lazarusidestrconsts:lisedtdefuseheaptrcunit msgid "use HeapTrc unit" msgstr "" #: lazarusidestrconsts:lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" msgstr "" #: lazarusidestrconsts:lisexttoolfailedtoruntool msgid "Failed to run tool" msgstr "" #: lazarusidestrconsts:lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts:lisexttoolexternaltools msgid "External tools" msgstr "" #: lazarusidestrconsts:lisexttoolremove msgid "Remove" msgstr "" #: lazarusidestrconsts:liskeepthemandcontinue msgid "Keep them and continue" msgstr "" #: lazarusidestrconsts:lisremovethem msgid "Remove them" msgstr "" #: lazarusidestrconsts:lisexttoolmoveup msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts:lisexttoolmovedown msgid "Down" msgstr "Dolů" #: lazarusidestrconsts:lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "" #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "" #: lazarusidestrconsts:lisedtexttooledittool msgid "Edit Tool" msgstr "Nástroj pro úpravy" #: lazarusidestrconsts:lisedtexttoolprogramfilename msgid "Programfilename:" msgstr "" #: lazarusidestrconsts:lisedtexttoolparameters msgid "Parameters:" msgstr "" #: lazarusidestrconsts:lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Pracovní složka:" #: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" msgstr "" #: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" msgstr "" #: lazarusidestrconsts:lisedtexttoolkey msgid "Key" msgstr "" #: lazarusidestrconsts:lisedtexttoolctrl msgid "Ctrl" msgstr "" #: lazarusidestrconsts:lisedtexttoolalt msgid "Alt" msgstr "Alt" #: lazarusidestrconsts:lisedtexttoolshift msgid "Shift" msgstr "" #: lazarusidestrconsts:lisedtexttoolmacros msgid "Macros" msgstr "" #: lazarusidestrconsts:lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "Pracovní složka pro sestavení" #: lazarusidestrconsts:lisworkingdirectoryforrun msgid "Working directory for run" msgstr "Pracovní složka pro spuštění" #: lazarusidestrconsts:lisconfigurebuild msgid "Configure Build %s" msgstr "" #: lazarusidestrconsts:lisedtexttoolinsert msgid "Insert" msgstr "" #: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "" #: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru." #: lazarusidestrconsts:lisfindfiletexttofind msgid "Text to find:" msgstr "Text k nalezení:" #: lazarusidestrconsts:lisfindfilecasesensitive msgid "Case sensitive" msgstr "" #: lazarusidestrconsts:lisfindfilewholewordsonly msgid "Whole words only" msgstr "Pouze celá slova" #: lazarusidestrconsts:lisfindfileregularexpressions msgid "Regular expressions" msgstr "" #: lazarusidestrconsts:lisfindfilemultiline msgid "Multiline pattern" msgstr "" #: lazarusidestrconsts:lisfindfilewhere msgid "Where" msgstr "Kde" #: lazarusidestrconsts:lisfindfilesearchallfilesinproject msgid "search all files in project" msgstr "" #: lazarusidestrconsts:lisfindfilesearchallopenfiles msgid "search all open files" msgstr "" #: lazarusidestrconsts:lisfindfilesearchindirectories msgid "search in directories" msgstr "" #: lazarusidestrconsts:lisfindfiledirectoryoptions msgid "Directory options" msgstr "Nastavení složky" #: lazarusidestrconsts:lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" msgstr "" #: lazarusidestrconsts:lisfindfileincludesubdirectories msgid "Include sub directories" msgstr "" #: lazarusidestrconsts:lisfindfileonlytextfiles msgid "Only text files" msgstr "" #: lazarusidestrconsts:lispkgmangpackage msgid "Package: %s" msgstr "" #: lazarusidestrconsts:lispkgmangproject msgid "Project: %s" msgstr "" #: lazarusidestrconsts:lispkgmanglazarus msgid "Lazarus" msgstr "" #: lazarusidestrconsts:lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Závislost bez vlastníka: %s" #: lazarusidestrconsts:lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "Neplatná přípona balíčku" #: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "" #: lazarusidestrconsts:lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "" #: lazarusidestrconsts:lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "" #: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "" #: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgstr "" #: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "" #: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgstr "" #: lazarusidestrconsts:lispkgmangreplacefile msgid "Replace File" msgstr "" #: lazarusidestrconsts:lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Smazat starý soubor balíčku?" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" msgstr "Odstranit starý soubor balíčku %s%s%s?" #: lazarusidestrconsts:lispkgmangdeletefailed msgid "Delete failed" msgstr "Odstranění selhalo" #: lazarusidestrconsts:lisambiguousunitfound msgid "Ambiguous Unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." msgstr "" #: lazarusidestrconsts:lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Odstranit všechny tyto soubory?" #: lazarusidestrconsts:lispkgmangunsavedpackage msgid "Unsaved package" msgstr "Neuložený balíček" #: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "" #: lazarusidestrconsts:lispkgmangbrokendependency msgid "Broken dependency" msgstr "Porušená závislost" #: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgstr "" #: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." msgstr "Požadovaný balíkček nenalezen. Podívejte se na graf balíčků." #: lazarusidestrconsts:lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" msgstr "" #: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "" #: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Nejednoznačné jednotky nalezeny" #: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem." #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangerrorwritingfile msgid "Error writing file" msgstr "" #: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangerrorreadingfile msgid "Error reading file" msgstr "" #: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatedirectory msgid "Unable to create directory" msgstr "" #: lazarusidestrconsts:lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "Nelze načíst balíček" #: lazarusidestrconsts:lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgstr "Nelze otevřít balíček %s%s%s.%sTento balíček byl označen k instalaci." #: lazarusidestrconsts:lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgstr "" #: lazarusidestrconsts:lispkgmangpackageconflicts msgid "Package conflicts" msgstr "" #: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." msgstr "" #: lazarusidestrconsts:lispkgmangsavepackage msgid "Save Package?" msgstr "" #: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgstr "" #: lazarusidestrconsts:lispkgmangnewpackage msgid "NewPackage" msgstr "Nový balíček" #: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" msgstr "" #: lazarusidestrconsts:lispackageneedsinstallation msgid "Package needs installation" msgstr "" #: lazarusidestrconsts:lispkgmangskipthispackage msgid "Skip this package" msgstr "" #: lazarusidestrconsts:lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "" #: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "Neplatné jméno souboru balíčku" #: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." msgstr "" #: lazarusidestrconsts:lispkgmangfilenotfound msgid "File %s%s%s not found." msgstr "" #: lazarusidestrconsts:lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "" #: lazarusidestrconsts:lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "" #: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgstr "" #: lazarusidestrconsts:lispkgmangsavepackage2 msgid "Save package?" msgstr "" #: lazarusidestrconsts:lispkgmangpackagefilemissing msgid "Package file missing" msgstr "" #: lazarusidestrconsts:lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." msgstr "" #: lazarusidestrconsts:lispkgmangpackagefilenotsaved msgid "Package file not saved" msgstr "" #: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." msgstr "" #: lazarusidestrconsts:lispkgmangignoreandsavepackagenow msgid "Ignore and save package now" msgstr "" #: lazarusidestrconsts:lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "" #: lazarusidestrconsts:lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "" #: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts:lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" msgstr "%sPodívejte se na Projekt -> Inspektor projektu" #: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "" #: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "" #: lazarusidestrconsts:lismissingpackages msgid "Missing Packages" msgstr "Chybějící balíčky" #: lazarusidestrconsts:lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" msgstr "" #: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangpackagemainsourcefile msgid "package main source file" msgstr "" #: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" msgstr "" #: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." msgstr "" #: lazarusidestrconsts:lispkgmangrenamefileinpackage msgid "Rename file in package?" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" msgstr "" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s%s" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s%s" #: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgstr "%sNásledující jednotky budou přidány do sekce uses jednotky %s%s:%s%s%s" #: lazarusidestrconsts:lisconfirmchanges msgid "Confirm changes" msgstr "" #: lazarusidestrconsts:lispkgmangfilenotsaved msgid "File not saved" msgstr "" #: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "" #: lazarusidestrconsts:lispkgmangfileisinproject msgid "File is in Project" msgstr "" #: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Varování: Soubor %s%s%s%spatří k aktuálnímu projektu." #: lazarusidestrconsts:lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "" #: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgstr "" #: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Automaticky instalované balíčky" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" msgstr "" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" msgstr "" #: lazarusidestrconsts:lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts:lispkgmangpackageisrequired msgid "Package is required" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgstr "" #: lazarusidestrconsts:lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "" #: lazarusidestrconsts:lispkgmanguninstallpackage2 msgid "Uninstall package %s?" msgstr "" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" #: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst msgid "Please save the package first." msgstr "" #: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" msgstr "" #: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." msgstr "" #: lazarusidestrconsts:lispkgsysinvalidunitname msgid "Invalid Unitname: %s" msgstr "" #: lazarusidestrconsts:lispkgsysunitnotfound msgid "Unit not found: %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" msgstr "" #: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" msgstr "" #: lazarusidestrconsts:lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "" #: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" msgstr "Třída komponenty %s%s%s je již definována." #: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." msgstr "" #: lazarusidestrconsts:lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sJméno jednotky: %s%s%s" #: lazarusidestrconsts:lispkgsysfilename msgid "%s%sFile Name: %s%s%s" msgstr "%s%sJméno souboru: %s%s%s" #: lazarusidestrconsts:lispkgsysregistrationerror msgid "Registration Error" msgstr "" #: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." msgstr "" #: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." msgstr "" #: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." msgstr "" #: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" msgstr "" #: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" msgstr "" #: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." msgstr "" #: lazarusidestrconsts:lispkgsysregisterprocedureisnil msgid "Register procedure is nil" msgstr "" #: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." msgstr "" #: lazarusidestrconsts:lispkgsyspackagefilenotfound msgid "Package file not found" msgstr "" #: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgstr "" #: lazarusidestrconsts:lispkgdefsoutputdirectory msgid "Output directory" msgstr "" #: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" msgstr "" #: lazarusidestrconsts:lispkgdefsunitpath msgid "Unit Path" msgstr "" #: lazarusidestrconsts:lisprojprojectsourcedirectorymark msgid "Project Source Directory Mark" msgstr "" #: lazarusidestrconsts:lispkgdefssrcdirmark msgid "Package Source Directory Mark" msgstr "" #: lazarusidestrconsts:lisaf2pinvalidpackage msgid "Invalid Package" msgstr "Neplatný balíček" #: lazarusidestrconsts:lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" msgstr "Neplatné ID balíčku: %s%s%s" #: lazarusidestrconsts:lisaf2ppackagenotfound msgid "Package %s%s%s not found." msgstr "" #: lazarusidestrconsts:lisaf2ppackageisreadonly msgid "Package is read only" msgstr "" #: lazarusidestrconsts:lisaf2pthepackageisreadonly msgid "The package %s is read only." msgstr "" #: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts:lisaf2punitname msgid "Unit Name: " msgstr "" #: lazarusidestrconsts:lisaf2phasregisterprocedure msgid "Has Register procedure" msgstr "" #: lazarusidestrconsts:lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" msgstr "Virtuální jednotka (zdrojové soubory nejsou v balíčku)" #: lazarusidestrconsts:lisaf2pfiletype msgid "File Type" msgstr "" #: lazarusidestrconsts:lisaf2pdestinationpackage msgid "Destination Package" msgstr "Cílový balíček" #: lazarusidestrconsts:lisaf2pshowall msgid "Show All" msgstr "" #: lazarusidestrconsts:lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Přidat soubor do balíčku" #: lazarusidestrconsts:lisa2pinvalidfilename msgid "Invalid filename" msgstr "" #: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts:lisa2pfilenotunit msgid "File not unit" msgstr "" #: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts:lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." msgstr "%s%s%s není platné jméno jednotky." #: lazarusidestrconsts:lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Jméno jednotky už existuje" #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." msgstr "" #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" msgstr "" #: lazarusidestrconsts:lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Nejednoznačné jméno jednotky" #: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." msgstr "" #: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." msgstr "" #: lazarusidestrconsts:lisa2pexistingfile msgid "%sExisting file: %s%s%s" msgstr "%sExistující soubor: %s%s%s" #: lazarusidestrconsts:lisa2pfilealreadyexists msgid "File already exists" msgstr "" #: lazarusidestrconsts:lisa2pfileisused msgid "File is used" msgstr "" #: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "" #: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "" #: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgstr "" #: lazarusidestrconsts:lisa2pfilealreadyinpackage msgid "File already in package" msgstr "" #: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." msgstr "Soubor %s%s%s už je v balíčku." #: lazarusidestrconsts:lisa2pinvalidfile msgid "Invalid file" msgstr "" #: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "" #: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisa2ppagenametoolong msgid "Page Name too long" msgstr "" #: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." msgstr "" #: lazarusidestrconsts:lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "" #: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." msgstr "" #: lazarusidestrconsts:lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "" #: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisa2pinvalidcircle msgid "Invalid Circle" msgstr "" #: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgstr "" #: lazarusidestrconsts:lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "Nejednoznačný typ předka" #: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Nejednoznačné jméno třídy" #: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "" #: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisa2paddunit msgid "Add Unit" msgstr "Přidat jednotku" #: lazarusidestrconsts:lisa2pnewfile msgid "New File" msgstr "Nový soubor" #: lazarusidestrconsts:lisa2pnewcomponent msgid "New Component" msgstr "Nová komponenta" #: lazarusidestrconsts:lisa2paddfile msgid "Add File" msgstr "Přidat soubor" #: lazarusidestrconsts:lisa2paddfiles msgid "Add Files" msgstr "Přidat soubory" #: lazarusidestrconsts:lisa2punitfilename msgid "Unit file name:" msgstr "" #: lazarusidestrconsts:lisa2pchooseanexistingfile msgid "" msgstr "" #: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" msgstr "Přidat soubory LFM a LRS pokud existují." #: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" msgstr "" #: lazarusidestrconsts:lisa2pancestortype msgid "Ancestor Type" msgstr "Typ předka" #: lazarusidestrconsts:lisa2pshowall msgid "Show all" msgstr "" #: lazarusidestrconsts:lisa2pnewclassname msgid "New class name:" msgstr "Nové jméno třídy:" #: lazarusidestrconsts:lisa2ppalettepage msgid "Palette Page:" msgstr "" #: lazarusidestrconsts:lisa2punitfilename2 msgid "Unit File Name:" msgstr "" #: lazarusidestrconsts:lisa2punitname msgid "Unit Name:" msgstr "" #: lazarusidestrconsts:lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "" #: lazarusidestrconsts:lisa2psavefiledialog msgid "Save file dialog" msgstr "" #: lazarusidestrconsts:lisa2pfilename msgid "File name:" msgstr "" #: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "" #: lazarusidestrconsts:lisa2pdependency msgid "Dependency" msgstr "Závislost" #: lazarusidestrconsts:lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Porušená závislost" #: lazarusidestrconsts:lisoipfilename msgid "Filename: %s" msgstr "" #: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" msgstr "%sTento balíček byl vytvořen automaticky" #: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen" #: lazarusidestrconsts:lisoipdescriptiondescription msgid "%sDescription: %s" msgstr "%sPopis: %s" #: lazarusidestrconsts:lisoipdescription msgid "Description: " msgstr "Popis: " #: lazarusidestrconsts:lisoippleaseselectapackage msgid "Please select a package" msgstr "" #: lazarusidestrconsts:lisoipnopackageselected msgid "No package selected" msgstr "" #: lazarusidestrconsts:lisoippleaseselectapackagetoopen msgid "Please select a package to open" msgstr "" #: lazarusidestrconsts:lisoippackagename msgid "Package Name" msgstr "" #: lazarusidestrconsts:lisoipstate msgid "State" msgstr "" #: lazarusidestrconsts:lisoipmodified msgid "modified" msgstr "změněný" #: lazarusidestrconsts:lisoipmissing msgid "missing" msgstr "chybějící" #: lazarusidestrconsts:lisoipinstalledstatic msgid "installed static" msgstr "" #: lazarusidestrconsts:lisoipinstalleddynamic msgid "installed dynamic" msgstr "" #: lazarusidestrconsts:lisoipautoinstallstatic msgid "auto install static" msgstr "automaticky instaluj statické" #: lazarusidestrconsts:lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "automaticky instaluj dynamické" #: lazarusidestrconsts:lisoipreadonly msgid "readonly" msgstr "" #: lazarusidestrconsts:lisoipopenloadedpackage msgid "Open loaded package" msgstr "" #: lazarusidestrconsts:lispckeditremovefile msgid "Remove file" msgstr "" #: lazarusidestrconsts:lispckeditreaddfile msgid "Re-Add file" msgstr "" #: lazarusidestrconsts:lispckeditremovedependency msgid "Remove dependency" msgstr "" #: lazarusidestrconsts:lispckeditmovedependencyup msgid "Move dependency up" msgstr "" #: lazarusidestrconsts:lispckeditmovedependencydown msgid "Move dependency down" msgstr "" #: lazarusidestrconsts:lispckeditreadddependency msgid "Re-Add dependency" msgstr "" #: lazarusidestrconsts:lispckeditsetdependencydefaultfilename msgid "Store dependency filename" msgstr "" #: lazarusidestrconsts:lispckeditcleardependencydefaultfilename msgid "Clear dependency filename" msgstr "" #: lazarusidestrconsts:lispckeditcompile msgid "Compile" msgstr "" #: lazarusidestrconsts:lispckeditrecompileclean msgid "Recompile clean" msgstr "" #: lazarusidestrconsts:lispckeditrecompileallrequired msgid "Recompile all required" msgstr "" #: lazarusidestrconsts:lispckeditcreatemakefile msgid "Create Makefile" msgstr "" #: lazarusidestrconsts:lispckeditaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts:lispckeditinstall msgid "Install" msgstr "" #: lazarusidestrconsts:lispckedituninstall msgid "Uninstall" msgstr "" #: lazarusidestrconsts:lispckeditviewpackgesource msgid "View Package Source" msgstr "" #: lazarusidestrconsts:lispckeditgeneraloptions msgid "General Options" msgstr "" #: lazarusidestrconsts:lispckeditsavechanges msgid "Save Changes?" msgstr "" #: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" msgstr "" #: lazarusidestrconsts:lispckeditpage msgid "%s, Page: %s" msgstr "%s,Stránka: %s" #: lazarusidestrconsts:lisfpfindpalettecomponent msgid "Find palette component" msgstr "" #: lazarusidestrconsts:lisfpcomponents msgid "Components" msgstr "Komponenty" #: lazarusidestrconsts:lispckeditremovefile2 msgid "Remove file?" msgstr "" #: lazarusidestrconsts:lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgstr "" #: lazarusidestrconsts:lispckeditremovedependency2 msgid "Remove Dependency?" msgstr "" #: lazarusidestrconsts:lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "" #: lazarusidestrconsts:lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "" #: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts:lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "" #: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts:lispckeditcompileeverything msgid "Compile everything?" msgstr "" #: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "" #: lazarusidestrconsts:lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" msgstr "Volby překladače pro balíček %s" #: lazarusidestrconsts:lispckeditsavepackage msgid "Save package" msgstr "" #: lazarusidestrconsts:lispckeditcompilepackage msgid "Compile package" msgstr "" #: lazarusidestrconsts:lispckeditaddanitem msgid "Add an item" msgstr "Přidat položku" #: lazarusidestrconsts:lispckeditremoveselecteditem msgid "Remove selected item" msgstr "" #: lazarusidestrconsts:lispckeditinstallpackageintheide msgid "Install package in the IDE" msgstr "" #: lazarusidestrconsts:lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Upravit obecné nastavení" #: lazarusidestrconsts:lispckeditcompopts msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts:lispckedithelp msgid "Help" msgstr "" #: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" msgstr "" #: lazarusidestrconsts:lispckeditmore msgid "More ..." msgstr "Více ..." #: lazarusidestrconsts:lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Upravit nastavení pro překlad balíčku" #: lazarusidestrconsts:lispckeditrequiredpackages msgid "Required Packages" msgstr "" #: lazarusidestrconsts:lispckeditfileproperties msgid "File Properties" msgstr "" #: lazarusidestrconsts:lispckeditregisterunit msgid "Register unit" msgstr "" #: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Volání %sRegistr%s procedura vybrané jednotky" #: lazarusidestrconsts:lispckeditregisteredplugins msgid "Registered plugins" msgstr "" #: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "Přidat jednotku do sekce uses v balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány." #: lazarusidestrconsts:lispkgmanguseunit msgid "Use unit" msgstr "Požít jednotku" #: lazarusidestrconsts:lispckeditminimumversion msgid "Minimum Version:" msgstr "Minimální verze:" #: lazarusidestrconsts:lispckeditmaximumversion msgid "Maximum Version:" msgstr "Maximální verze:" #: lazarusidestrconsts:lispckeditapplychanges msgid "Apply changes" msgstr "Použít změny" #: lazarusidestrconsts:lispckeditpackage msgid "Package %s" msgstr "" #: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts:lispckeditdependencyproperties msgid "Dependency Properties" msgstr "Vlastnsoti závislosti" #: lazarusidestrconsts:lispckeditpackagenotsaved msgid "package %s not saved" msgstr "" #: lazarusidestrconsts:lispckeditreadonly msgid "Read Only: %s" msgstr "" #: lazarusidestrconsts:lispckeditmodified msgid "Modified: %s" msgstr "Změněný: %s" #: lazarusidestrconsts:lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Nová jednotka není v cestě jednotek" #: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" msgstr "" #: lazarusidestrconsts:lispkgeditrevertpackage msgid "Revert package?" msgstr "" #: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?" #: lazarusidestrconsts:lispckoptsusage msgid "Usage" msgstr "Použití" #: lazarusidestrconsts:lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "" #: lazarusidestrconsts:lispckoptsideintegration msgid "IDE Integration" msgstr "" #: lazarusidestrconsts:lispckoptsprovides msgid "Provides" msgstr "" #: lazarusidestrconsts:lispckoptsdescriptionabstract msgid "Description/Abstract" msgstr "Popis/obsah" #: lazarusidestrconsts:lispckoptsauthor msgid "Author:" msgstr "Autor:" #: lazarusidestrconsts:lispckoptslicense msgid "License:" msgstr "" #: lazarusidestrconsts:lispckoptsmajor msgid "Major" msgstr "" #: lazarusidestrconsts:lispckoptsminor msgid "Minor" msgstr "Minoritní" #: lazarusidestrconsts:lispckoptsrelease msgid "Release" msgstr "" #: lazarusidestrconsts:lisbuildnumber msgid "Build Number" msgstr "Číslo sestavení" #: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" msgstr "Automaticky zvyšovat číslo verze při sestavení" #: lazarusidestrconsts:lispckoptspackagetype msgid "PackageType" msgstr "" #: lazarusidestrconsts:lispckoptsdesigntimeonly msgid "Designtime only" msgstr "Pouze doba návrhu" #: lazarusidestrconsts:lispckoptsruntimeonly msgid "Runtime only" msgstr "" #: lazarusidestrconsts:lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" msgstr "Doba návrhu a doba kompilace" #: lazarusidestrconsts:lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "Aktualizovat/Znovu sestavit" #: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Automaticky znovu sestavit podle potřeby" #: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Automaticky znovu sestav pokud znovu sestavení všeho" #: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "" #: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation msgid "LazDoc - Lazarus documentation" msgstr "" #: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Přidat cesty do závislých balíčků/projektů" #: lazarusidestrconsts:lispckoptsinclude msgid "Include" msgstr "" #: lazarusidestrconsts:lispckoptsobject msgid "Object" msgstr "" #: lazarusidestrconsts:lispckoptslibrary msgid "Library" msgstr "" #: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Přidat volby do závislých balíčků a projektů" #: lazarusidestrconsts:lispckoptslinker msgid "Linker" msgstr "" #: lazarusidestrconsts:lispckoptscustom msgid "Custom" msgstr "" #: lazarusidestrconsts:lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "Neplatný typ balíčku" #: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgstr "" #: lazarusidestrconsts:lispckoptspackageoptions msgid "Package Options" msgstr "" #: lazarusidestrconsts:lispckexplloadedpackages msgid "Loaded Packages:" msgstr "" #: lazarusidestrconsts:lispckexplisrequiredby msgid "Selected package is required by:" msgstr "" #: lazarusidestrconsts:lispckexplpackagenotfound msgid "Package %s not found" msgstr "" #: lazarusidestrconsts:lispckexplstate msgid "%sState: " msgstr "%sStav: " #: lazarusidestrconsts:lispckexplautocreated msgid "AutoCreated" msgstr "Automaticky vytvořeno" #: lazarusidestrconsts:lispckexplinstalled msgid "Installed" msgstr "" #: lazarusidestrconsts:lispckexplinstallonnextstart msgid "Install on next start" msgstr "" #: lazarusidestrconsts:lispckexpluninstallonnextstart msgid "Uninstall on next start" msgstr "" #: lazarusidestrconsts:lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "" #: lazarusidestrconsts:lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "" #: lazarusidestrconsts:lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" msgstr "Odstranit závislost pro %s?" #: lazarusidestrconsts:lisprojinspremovefilefromproject msgid "Remove file %s from project?" msgstr "" #: lazarusidestrconsts:lisprojinspremovedrequiredpackages msgid "Removed required packages" msgstr "" #: lazarusidestrconsts:lisprojinspprojectinspector msgid "Project Inspector - %s" msgstr "" #: lazarusidestrconsts:lismenueditormenueditor msgid "Menu Editor" msgstr "Editor menu" #: lazarusidestrconsts:lismenueditorselectmenu msgid "Select Menu:" msgstr "" #: lazarusidestrconsts:lismenueditorselecttemplate msgid "Select Template:" msgstr "" #: lazarusidestrconsts:lismenueditortemplatepreview msgid "Template Preview" msgstr "" #: lazarusidestrconsts:lismenueditornewtemplatedescription msgid "New Template Description..." msgstr "Nový popis šablony..." #: lazarusidestrconsts:lismenueditorcancel msgid "Cancel" msgstr "" #: lazarusidestrconsts:lismenueditorinsertnewitemafter msgid "Insert New Item (after)" msgstr "" #: lazarusidestrconsts:lismenueditorinsertnewitembefore msgid "Insert New Item (before)" msgstr "" #: lazarusidestrconsts:lismenueditordeleteitem msgid "Delete Item" msgstr "Odstranit položku" #: lazarusidestrconsts:lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "" #: lazarusidestrconsts:lismenueditorhandleonclickevent msgid "Handle OnClick Event" msgstr "" #: lazarusidestrconsts:lismenueditormoveup msgid "Move Up (or left)" msgstr "" #: lazarusidestrconsts:lismenueditormovedown msgid "Move Down (or right)" msgstr "" #: lazarusidestrconsts:lismenueditorinsertfromtemplate msgid "Insert From Template..." msgstr "" #: lazarusidestrconsts:lismenueditorsaveastemplate msgid "Save As Template..." msgstr "" #: lazarusidestrconsts:lismenueditordeletefromtemplate msgid "Delete From Template..." msgstr "Odstranit ze šablony..." #: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" msgstr "" #: lazarusidestrconsts:lismenutemplatefile msgid "File" msgstr "" #: lazarusidestrconsts:lismenutemplatenew msgid "New" msgstr "Nový" #: lazarusidestrconsts:liskmnewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts:lismenutemplateopen msgid "Open" msgstr "" #: lazarusidestrconsts:lismenutemplateopenrecent msgid "Open Recent" msgstr "" #: lazarusidestrconsts:lismenutemplatesave msgid "Save" msgstr "" #: lazarusidestrconsts:lismenutemplatesaveas msgid "Save As" msgstr "" #: lazarusidestrconsts:lismenutemplateclose msgid "Close" msgstr "" #: lazarusidestrconsts:lismenutemplateexit msgid "Exit" msgstr "" #: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" msgstr "" #: lazarusidestrconsts:lismenutemplateedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts:lismenutemplateundo msgid "Undo" msgstr "" #: lazarusidestrconsts:lismenutemplateredo msgid "Redo" msgstr "" #: lazarusidestrconsts:lismenutemplatecut msgid "Cut" msgstr "" #: lazarusidestrconsts:lismenutemplatecopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:lismenutemplatepaste msgid "Paste" msgstr "" #: lazarusidestrconsts:lismenutemplatefind msgid "Find" msgstr "" #: lazarusidestrconsts:lismenutemplatefindnext msgid "Find Next" msgstr "" #: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" msgstr "" #: lazarusidestrconsts:lismenutemplatehelp msgid "Help" msgstr "" #: lazarusidestrconsts:lismenutemplatecontents msgid "Contents" msgstr "" #: lazarusidestrconsts:lismenutemplatetutorial msgid "Tutorial" msgstr "" #: lazarusidestrconsts:lismenutemplateabout msgid "About" msgstr "O aplikaci" #: lazarusidestrconsts:liscontributors msgid "Contributors" msgstr "" #: lazarusidestrconsts:lisacknowledgements msgid "Acknowledgements" msgstr "Poděkování" #: lazarusidestrconsts:lischaractermap msgid "Character Map" msgstr "" #: lazarusidestrconsts:lisctdefchoosedirectory msgid "Choose Directory" msgstr "" #: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "" #: lazarusidestrconsts:lisctdefvariable msgid "Variable: %s" msgstr "Proměnná: %s" #: lazarusidestrconsts:lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts:lisctdefvariablename msgid "Variable Name" msgstr "Jméno proměné" #: lazarusidestrconsts:liscldircleansubdirectories msgid "Clean sub directories" msgstr "" #: lazarusidestrconsts:liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "" #: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "" #: lazarusidestrconsts:liscldirkeepalltextfiles msgid "Keep all text files" msgstr "" #: lazarusidestrconsts:liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "" #: lazarusidestrconsts:liscldircleandirectory msgid "Clean Directory" msgstr "" #: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgstr "" #: lazarusidestrconsts:lisfixlfmfile msgid "Fix LFM file" msgstr "" #: lazarusidestrconsts:lismissingevents msgid "Missing Events" msgstr "Chybějící události" #: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgstr "" #: lazarusidestrconsts:lisnocodeselected msgid "No code selected" msgstr "Nevybraný žádný kód" #: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts:lisinvalidselection msgid "Invalid selection" msgstr "" #: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts:lisextractprocedure msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts:lisnameofnewprocedure msgid "Name of new procedure" msgstr "Jméno nové procedury" #: lazarusidestrconsts:lisextract msgid "Extract" msgstr "" #: lazarusidestrconsts:lisinvalidprocname msgid "Invalid proc name" msgstr "" #: lazarusidestrconsts:lispublicmethod msgid "Public Method" msgstr "" #: lazarusidestrconsts:lisprivatemethod msgid "Private Method" msgstr "Soukromá metoda" #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "" #: lazarusidestrconsts:lispublishedmethod msgid "Published Method" msgstr "" #: lazarusidestrconsts:lisprocedure msgid "Procedure" msgstr "" #: lazarusidestrconsts:lisprocedurewithinterface msgid "Procedure with interface" msgstr "" #: lazarusidestrconsts:lissubprocedure msgid "Sub Procedure" msgstr "" #: lazarusidestrconsts:lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "" #: lazarusidestrconsts:lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "" #: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." msgstr "" #: lazarusidestrconsts:lisinvalidcompilerfilename msgid "Invalid Compiler Filename" msgstr "" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplz msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlz check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" msgstr "" #: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" msgstr "" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lislazarusdirectorynotfound msgid "Lazarus directory not found" msgstr "" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlz check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lishlpoptshelpoptions msgid "Help Options" msgstr "" #: lazarusidestrconsts:lishlpoptsviewers msgid "Viewers" msgstr "" #: lazarusidestrconsts:lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "" #: lazarusidestrconsts:lishlpoptsproperties msgid "Properties:" msgstr "" #: lazarusidestrconsts:lishlpoptsdatabases msgid "Databases" msgstr "" #: lazarusidestrconsts:lisencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts:lisenclose msgid "Enclose" msgstr "" #: lazarusidestrconsts:lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "" #: lazarusidestrconsts:liserrors msgid "Errors" msgstr "" #: lazarusidestrconsts:lislfmfile msgid "LFM file" msgstr "" #: lazarusidestrconsts:lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "" #: lazarusidestrconsts:liscomptest msgid "Test" msgstr "Test" #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" #: lazarusidestrconsts:lisa2paddfilestopackage msgid "Add files to package" msgstr "Přidat soubory do balíčku" #: lazarusidestrconsts:lisa2paddtopackage msgid "Add to package" msgstr "Přidat do balíčku" #: lazarusidestrconsts:lisa2pfilename2 msgid "Filename" msgstr "" #: lazarusidestrconsts:lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "" #: lazarusidestrconsts:lishelpselectordialog msgid "Help selector" msgstr "" #: lazarusidestrconsts:lisselectahelpitem msgid "Select a help item:" msgstr "" #: lazarusidestrconsts:liserrormovingcomponent msgid "Error moving component" msgstr "" #: lazarusidestrconsts:liserrormovingcomponent2 msgid "Error moving component %s:%s" msgstr "" #: lazarusidestrconsts:lisinstalledpackages msgid "Installed Packages" msgstr "" #: lazarusidestrconsts:lisavailablepackages msgid "Available packages" msgstr "Dostupné balíčky" #: lazarusidestrconsts:lisexportlist msgid "Export list" msgstr "" #: lazarusidestrconsts:lisimportlist msgid "Import list" msgstr "" #: lazarusidestrconsts:lisuninstallselection msgid "Uninstall selection" msgstr "" #: lazarusidestrconsts:lispackagestoinstallintheide msgid "Packages to install in the IDE" msgstr "" #: lazarusidestrconsts:lisinstallselection msgid "Install selection" msgstr "" #: lazarusidestrconsts:lispackageinfo msgid "Package Info" msgstr "" #: lazarusidestrconsts:lissaveandrebuildide msgid "Save and rebuild IDE" msgstr "" #: lazarusidestrconsts:lissaveandexitdialog msgid "Save and exit dialog" msgstr "" #: lazarusidestrconsts:lisalignment msgid "Alignment" msgstr "Zarovnání" #: lazarusidestrconsts:lishorizontal msgid "Horizontal" msgstr "" #: lazarusidestrconsts:lisnochange msgid "No change" msgstr "" #: lazarusidestrconsts:listops msgid "Tops" msgstr "" #: lazarusidestrconsts:lisleftsides msgid "Left sides" msgstr "" #: lazarusidestrconsts:liscenters msgid "Centers" msgstr "" #: lazarusidestrconsts:lisbottoms msgid "Bottoms" msgstr "Spodní části" #: lazarusidestrconsts:lisrightsides msgid "Right sides" msgstr "" #: lazarusidestrconsts:liscenterinwindow msgid "Center in window" msgstr "" #: lazarusidestrconsts:lisspaceequally msgid "Space equally" msgstr "" #: lazarusidestrconsts:listopspaceequally msgid "Top space equally" msgstr "" #: lazarusidestrconsts:lisbottomspaceequally msgid "Bottom space equally" msgstr "" #: lazarusidestrconsts:lisleftspaceequally msgid "Left space equally" msgstr "" #: lazarusidestrconsts:lisrightspaceequally msgid "Right space equally" msgstr "" #: lazarusidestrconsts:lisvertical msgid "Vertical" msgstr "Svislý" #: lazarusidestrconsts:lisscalingfactor msgid "Scaling factor:" msgstr "" #: lazarusidestrconsts:liscustomprogram msgid "Custom Program" msgstr "" #: lazarusidestrconsts:lisprogram msgid "Program" msgstr "Program" #: lazarusidestrconsts:lisconsoleapplication msgid "Console application" msgstr "" #: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts:liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." msgstr "" #: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." msgstr "" #: lazarusidestrconsts:lisnpselectaprojecttype msgid "Select a project type" msgstr "" #: lazarusidestrconsts:lisnpcreateanewproject msgid "Create a new project" msgstr "" #: lazarusidestrconsts:lisnpcreate msgid "Create" msgstr "Vytvořit" #: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "" #: lazarusidestrconsts:lisoifaddtofavouriteproperties msgid "Add to favourite properties" msgstr "Přidat do oblíbených vlastností" #: lazarusidestrconsts:lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" msgstr "" #: lazarusidestrconsts:lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "" #: lazarusidestrconsts:lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." msgstr "" #: lazarusidestrconsts:liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "" #: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "" #: lazarusidestrconsts:lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "Nelze získat zdroj pro návrhář." #: lazarusidestrconsts:lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "Nelze získat změny v editoru." #: lazarusidestrconsts:lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "" #: lazarusidestrconsts:lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" msgstr "%s%sNelze změnit jméno třídy %s na %s" #: lazarusidestrconsts:liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "" #: lazarusidestrconsts:lisoldclass msgid "Old Class" msgstr "" #: lazarusidestrconsts:lisnewclass msgid "New Class" msgstr "Nová třída" #: lazarusidestrconsts:lisoldancestors msgid "Old Ancestors" msgstr "" #: lazarusidestrconsts:lisnewancestors msgid "New Ancestors" msgstr "Nový předek" #: lazarusidestrconsts:lisceocodeexplorer msgid "CodeExplorer Options" msgstr "" #: lazarusidestrconsts:lisceoupdate msgid "Update" msgstr "Aktualizovat" #: lazarusidestrconsts:lisceorefreshautomatically msgid "Refresh automatically" msgstr "" #: lazarusidestrconsts:lisceoneveronlymanually msgid "Never, only manually" msgstr "Nikdy, pouze ručně" #: lazarusidestrconsts:lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "Když přepínání souboru v zdrojovém editoru" #: lazarusidestrconsts:lisceoonidle msgid "On idle" msgstr "" #: lazarusidestrconsts:liscefollowcursor msgid "Follow cursor" msgstr "" #: lazarusidestrconsts:lismenulazdoc msgid "LazDoc Editor" msgstr "" #: lazarusidestrconsts:lislazdocmainformcaption msgid "LazDoc editor" msgstr "" #: lazarusidestrconsts:lislazdocnotagcaption msgid "" msgstr "<ŽÁDNÝ>" #: lazarusidestrconsts:lislazdocnodocumentation msgid "Documentation entry does not exist" msgstr "Položka dokumentace neexistuje" #: lazarusidestrconsts:lislazdocinherited msgid "Inherited" msgstr "" #: lazarusidestrconsts:lislazdocshorttag msgid "Short" msgstr "" #: lazarusidestrconsts:lislazdocdescrtag msgid "Description" msgstr "Popis" #: lazarusidestrconsts:lislazdocerrorstag msgid "Errors" msgstr "" #: lazarusidestrconsts:lislazdocseealsotag msgid "See also" msgstr "" #: lazarusidestrconsts:lislazdocaddpathbutton msgid "Add path" msgstr "Přidat cestu" #: lazarusidestrconsts:lislazdocdeletepathbutton msgid "Remove path" msgstr "" #: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" msgstr "" #: lazarusidestrconsts:lislazdocpathsgroupbox msgid "LazDoc settings" msgstr "" #: lazarusidestrconsts:lislazdochintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts:lislazdochintitalicformat msgid "Insert italic formatting tag" msgstr "" #: lazarusidestrconsts:lislazdochintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts:lislazdochintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts:lislazdochintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts:lislazdochintvartag msgid "Insert var formatting tag" msgstr "" #: lazarusidestrconsts:lislazdocaddlinkbutton msgid "Add link" msgstr "Přidat odkaz" #: lazarusidestrconsts:lislazdocdeletelinkbutton msgid "Delete link" msgstr "Odstranit odkaz" #: lazarusidestrconsts:lislazdocexampletag msgid "Example" msgstr "" #: lazarusidestrconsts:lislazdocbrowseexamplebutton msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts:lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "" #: lazarusidestrconsts:lisldcopyfrominherited msgid "Copy from inherited" msgstr "Kopírovat ze zděděného" #: lazarusidestrconsts:lisenablemacros msgid "Enable Macros" msgstr "Povolit makra" #: lazarusidestrconsts:lisctselectcodemacro msgid "Select Code Macro" msgstr "" #: lazarusidestrconsts:lispdprogress msgid "Progress" msgstr "Průběh" #: lazarusidestrconsts:lispdabort msgid "Abort" msgstr "Přerušit" #: lazarusidestrconsts:lisposaveinlpifil msgid "Save in .lpi file" msgstr "" #: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "" #: lazarusidestrconsts:lisposaveinideconfigdirectory msgid "Save in IDE config directory" msgstr "" #: lazarusidestrconsts:lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "Neukládat žádné informace o sezení" #: lazarusidestrconsts:lisposavesessioninformationin msgid "Save session information in" msgstr "" #: lazarusidestrconsts:lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "" #: lazarusidestrconsts:lisshowoldtaborder msgid "Show old tab order" msgstr "" #: lazarusidestrconsts:listaborderof msgid "Tab Order of" msgstr "" #: lazarusidestrconsts:lisanchorenabledhint msgid "Enabled = Include %s in Anchors" msgstr "Povolený = Včetně %s v kotvách" #: lazarusidestrconsts:lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "" #: lazarusidestrconsts:listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "" #: lazarusidestrconsts:lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "" #: lazarusidestrconsts:lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "" #: lazarusidestrconsts:lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "" #: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling" msgstr "" #: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" msgstr "" #: lazarusidestrconsts:lisanchortotopsidekeepborderspace msgid "Anchor to top side of sibling, keep border space" msgstr "" #: lazarusidestrconsts:lisanchortobottomsidekeepborderspace msgid "Anchor to bottom side of sibling, keep border space" msgstr "" #: lazarusidestrconsts:lisanchortoleftsidekeepborderspace msgid "Anchor to left side of sibling, keep border space" msgstr "" #: lazarusidestrconsts:lisanchortorightsidekeepborderspace msgid "Anchor to right side of sibling, keep border space" msgstr "" #: lazarusidestrconsts:listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisborderspace msgid "BorderSpace" msgstr "" #: lazarusidestrconsts:lissibling msgid "Sibling" msgstr "" #: lazarusidestrconsts:lisenabled msgid "Enabled" msgstr "Povolený" #: lazarusidestrconsts:lisrightanchoring msgid "Right anchoring" msgstr "" #: lazarusidestrconsts:listopanchoring msgid "Top anchoring" msgstr "" #: lazarusidestrconsts:lisleftgroupboxcaption msgid "Left anchoring" msgstr "" #: lazarusidestrconsts:lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "Dolní ukotvení" #: lazarusidestrconsts:lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "" #: lazarusidestrconsts:lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "" #: lazarusidestrconsts:lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Doplňující prohledávací cesty" #: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmeventlog msgid "Event Log" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto msgid "Limit linecount to" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Bod přerušení" #: lazarusidestrconsts:lisdebugoptionsfrmprocess msgid "Process" msgstr "Proces" #: lazarusidestrconsts:lisdebugoptionsfrmthread msgid "Thread" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmmodule msgid "Module" msgstr "Modul" #: lazarusidestrconsts:lisdebugoptionsfrmoutput msgid "Output" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmwindow msgid "Window" msgstr "Okno" #: lazarusidestrconsts:lisdebugoptionsfrminterface msgid "Interface" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions msgid "Break on Lazarus Exceptions" msgstr "Přerušit při vyjímce Lazarusu" #: lazarusidestrconsts:lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmsignals msgid "Signals" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts:lisdebugoptionsfrmid msgid "ID" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmresume msgid "Resume" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmresumehandled msgid "Resume Handled" msgstr "" #: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled msgid "Resume Unhandled" msgstr "" #: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage msgid "Help for FreePascal Compiler message" msgstr "" #: lazarusidestrconsts:lisrelativepaths msgid "Relative paths" msgstr "" #: lazarusidestrconsts:lislazbuildsavesettings msgid "Save settings" msgstr "" #: lazarusidestrconsts:rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" msgstr "" #: lazarusidestrconsts:liswlwatchlist msgid "Watch list" msgstr "Seznam sledování" #: lazarusidestrconsts:liswlexpression msgid "Expression" msgstr "" #: lazarusidestrconsts:liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "" #: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme msgid "Note: All keys will be set to the values of the choosen scheme." msgstr "" #: lazarusidestrconsts:liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "" #: lazarusidestrconsts:lisifdok msgid "OK" msgstr "" #: lazarusidestrconsts:lispvueditvirtualunit msgid "Edit virtual unit" msgstr "Upravit virtuální jednotku" #: lazarusidestrconsts:versioninfotitle msgid "Version Info" msgstr "Informace o verzi" #: lazarusidestrconsts:lisplistobjects msgid "&Objects" msgstr "&Objekty" #: lazarusidestrconsts:lisplistjumptoselection msgid "Jump To Selection" msgstr "" #: lazarusidestrconsts:lisplistfilterany msgid "Filter by matching any part of method" msgstr "" #: lazarusidestrconsts:lisplistfilterstart msgid "Filter by matching with start of method" msgstr "" #: lazarusidestrconsts:lisplistchangefont msgid "Change Font" msgstr "" #: lazarusidestrconsts:lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "" #: lazarusidestrconsts:lisplisttype msgid "Type" msgstr "" #: lazarusidestrconsts:lisplistall msgid "" msgstr "" #: lazarusidestrconsts:lisplistnone msgid "" msgstr "<žádný>" #: lazarusidestrconsts:lisuiclearincludedbyreference msgid "Clear include cache" msgstr "" #: lazarusidestrconsts:lischangeparent msgid "Change parent ..." msgstr "" #: lazarusidestrconsts:lislazaruside msgid "Lazarus IDE" msgstr "" #: lazarusidestrconsts:lisdirectives msgid "Directives" msgstr "Pokyny" #: lazarusidestrconsts:rscreatenewdefine msgid "Create new define" msgstr "" #: lazarusidestrconsts:rsconditionaldefines msgid "Conditional defines" msgstr "Podmíněné definice" #: lazarusidestrconsts:rsaddinverse msgid "Add Inverse" msgstr "Přidat inverzi" #: lazarusidestrconsts:rsremove msgid "&Remove" msgstr "&Odstranit" #: lazarusidestrconsts:lisautomaticallyonlinebreak msgid "line break" msgstr "" #: lazarusidestrconsts:lisautomaticallyonspace msgid "space" msgstr "" #: lazarusidestrconsts:lisautomaticallyonwordend msgid "word end" msgstr "konec slova" #: lazarusidestrconsts:lisautomaticallyonaddsymbol msgid "symbol" msgstr "" #: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "" #: lazarusidestrconsts:lispldpackagelinks msgid "Package Links" msgstr ""