msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: 2009-01-07 19:03+0100\n" "Last-Translator: Chronos \n" "Translation-Source: http://tv.zdechov.net/svn/lazarus_czech/\n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" #: lazarusidestrconsts:liserrinvalidoption msgid "Invalid option at position %d: \"%s\"" msgstr "Nesprávná volba na pozici %d: \"%s\"" #: lazarusidestrconsts:liserrnooptionallowed msgid "Option at position %d does not allow an argument: %s" msgstr "Volba na pozici %d nepovoluje argument: %s" #: lazarusidestrconsts:liserroptionneeded msgid "Option at position %d needs an argument : %s" msgstr "Volba na pozici %d potřebuje argument : %s" #: lazarusidestrconsts:lisentertransla msgid "Enter translation language" msgstr "Zadejte překladový jazyk" #: lazarusidestrconsts:lislazarusversionstring msgid "%s beta" msgstr "%s beta" #: lazarusidestrconsts:lisleaveemptyfo msgid "Leave empty for default .po file" msgstr "Nechejte prázdné pro výchozí soubor .po" #: lazarusidestrconsts:lismenucollectpofil msgid "Collect .po files" msgstr "Sbírat soubory .po" #: lazarusidestrconsts:lismenucreatepofile msgid "Create .po files" msgstr "Vytvořit soubory .po" #: lazarusidestrconsts:listhishelpmessage msgid "this help message" msgstr "tato zpráva nápovědy" #: lazarusidestrconsts:lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " msgstr "hlavní konfigurační složka, kde Lazarus uchovává své konfigurační soubory. Implicitní je " #: lazarusidestrconsts:lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [volby] " #: lazarusidestrconsts:lisideoptions msgid "IDE Options:" msgstr "Volby IDE:" #: lazarusidestrconsts:liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "Volby rozhraní LCL:" #: lazarusidestrconsts:lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "Nezobrazovat úvodní obrázek při startu" #: lazarusidestrconsts:lisskiploadinglastproject msgid "Skip loading last project" msgstr "Přeskočit načtení posledního projektu" #: lazarusidestrconsts:lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varinaty se podívejte na soubory ve složce jazyků." #: lazarusidestrconsts:lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " msgstr "druhotná konfigurační složka, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je " #: lazarusidestrconsts:lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "soubor, kam je zapisován ladící výstup. Pokud není uveden, ladící výstup je vypisován do konzoly." #: lazarusidestrconsts:lisselectiontool msgid "Selection tool" msgstr "Nástroj výběru" #: lazarusidestrconsts:liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Sloupec kurzoru v aktuálním editoru" #: lazarusidestrconsts:liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "Řádek kurzoru v aktuálním editoru" #: lazarusidestrconsts:liscompilerfilename msgid "Compiler filename" msgstr "Jméno souboru překladače" #: lazarusidestrconsts:liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Slovo na pozici kurzoru v aktuálním editoru" #: lazarusidestrconsts:lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "" #: lazarusidestrconsts:lisfreepascalsourcedirectory msgid "Freepascal source directory" msgstr "Zdrojová složka Freepascalu" #: lazarusidestrconsts:lislazarusdirectory msgid "Lazarus directory" msgstr "Složka Lazarusu" #: lazarusidestrconsts:lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "ID jazyka Lazarusu (např. en, de, br, cz)" #: lazarusidestrconsts:lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "Jméno jazyka Lazarusu (např. english, czech)" #: lazarusidestrconsts:lislclwidgettype msgid "LCL Widget Type" msgstr "" #: lazarusidestrconsts:liscovarious msgid "%s (various)" msgstr "%s (různé)" #: lazarusidestrconsts:listargetcpu msgid "Target CPU" msgstr "Cílový CPU" #: lazarusidestrconsts:listargetos msgid "Target OS" msgstr "Cílový OS" #: lazarusidestrconsts:liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Parametry příkazového řádku programu" #: lazarusidestrconsts:lispromptforvalue msgid "Prompt for value" msgstr "Dotázat se na hodnotu" #: lazarusidestrconsts:lisprojectfilename msgid "Project filename" msgstr "Jméno souboru projektu" #: lazarusidestrconsts:lisprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts:lissavecurrenteditorfile msgid "save current editor file" msgstr "uložit aktuální editovaný soubor" #: lazarusidestrconsts:lissaveallmodified msgid "save all modified files" msgstr "Uložit všechny upravené soubory" #: lazarusidestrconsts:listargetfilenameofproject msgid "Target filename of project" msgstr "Cílové jméno souboru projektu" #: lazarusidestrconsts:listargetfilenameplusparams msgid "Target filename + params" msgstr "Cílové jméno souboru + parametry" #: lazarusidestrconsts:listestdirectory msgid "Test directory" msgstr "Testovací složka" #: lazarusidestrconsts:lislaunchingcmdline msgid "Launching target command line" msgstr "Spouštění cílové příkazové řádky" #: lazarusidestrconsts:lispublishprojdir msgid "Publish project directory" msgstr "Zveřejni adresář projektu" #: lazarusidestrconsts:lisprojectunitpath msgid "Project Unit Path" msgstr "Cesta jednotek projektu" #: lazarusidestrconsts:lisprojectincpath msgid "Project Include Path" msgstr "Cesta začleněných souborů projektu" #: lazarusidestrconsts:lisprojectsrcpath msgid "Project Src Path" msgstr "Zdrojová cesta projektu" #: lazarusidestrconsts:lisusershomedirectory msgid "User's home directory" msgstr "Uživatelský domovský adresář" #: lazarusidestrconsts:lismakeexe msgid "Make Executable" msgstr "Vytvořit spustitelný" #: lazarusidestrconsts:lisprojectmacroproperties msgid "Project macro properties" msgstr "Vlastnosti makra projektu" #: lazarusidestrconsts:lisopenproject2 msgid "Open project" msgstr "Otevřít projekt" #: lazarusidestrconsts:liskmsaveproject msgid "Save project" msgstr "Uložit projekt" #: lazarusidestrconsts:liskmcloseproject msgid "Close project" msgstr "Zavřít projekt" #: lazarusidestrconsts:liskmsaveprojectas msgid "Save project as" msgstr "Uložit projekt jako" #: lazarusidestrconsts:liskmpublishproject msgid "Publish project" msgstr "Zveřejnit projekt" #: lazarusidestrconsts:lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "Otevřít soubor jako normální zdrojový soubor" #: lazarusidestrconsts:lisopenasxmlfile msgid "Open as XML file" msgstr "Otevřít jako XML soubor" #: lazarusidestrconsts:lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgstr "Při posledním startu došlo k chybě při načítání %s!%s%sNačíst znovu tento projekt?" #: lazarusidestrconsts:lisopenprojectagain msgid "Open project again" msgstr "Otevřít projekt znovu" #: lazarusidestrconsts:lisstartwithanewproject msgid "Start with a new project" msgstr "Začít s novým projektem" #: lazarusidestrconsts:lisprojectmacrounitpath msgid "macro ProjectUnitPath" msgstr "" #: lazarusidestrconsts:lisconfigdirectory msgid "Lazarus config directory" msgstr "Konfigurační adresář Lazarusu" #: lazarusidestrconsts:lismenufile msgid "&File" msgstr "&Soubor" #: lazarusidestrconsts:lismenuedit msgid "&Edit" msgstr "&Editace" #: lazarusidestrconsts:lismenusearch msgid "&Search" msgstr "&Hledat" #: lazarusidestrconsts:lismenuview msgid "&View" msgstr "&Zobrazení" #: lazarusidestrconsts:lismenuproject msgid "&Project" msgstr "&Projekt" #: lazarusidestrconsts:lismenurun msgid "&Run" msgstr "&Spustit" #: lazarusidestrconsts:lismenupackage msgid "&Package" msgstr "&Balíček" #: lazarusidestrconsts:lismenutools msgid "&Tools" msgstr "&Nástroje" #: lazarusidestrconsts:lismenuenvironent msgid "E&nvironment" msgstr "P&rostředí" #: lazarusidestrconsts:lismenuwindow msgid "&Window" msgstr "&Okno" #: lazarusidestrconsts:lismenuhelp msgid "&Help" msgstr "&Nápověda" #: lazarusidestrconsts:lismenunewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts:lismenunewform msgid "New Form" msgstr "Nový formulář" #: lazarusidestrconsts:lismenunewother msgid "New ..." msgstr "Nový..." #: lazarusidestrconsts:lismenuopen msgid "Open ..." msgstr "Otevřít..." #: lazarusidestrconsts:lismenurevert msgid "Revert" msgstr "Navrátit" #: lazarusidestrconsts:lispkgeditpublishpackage msgid "Publish Package" msgstr "Vydat balíček" #: lazarusidestrconsts:lismenuopenrecent msgid "Open Recent ..." msgstr "Otevřít nedávný..." #: lazarusidestrconsts:lismenusave msgid "Save" msgstr "Uložit" #: lazarusidestrconsts:liskmsaveas msgid "SaveAs" msgstr "UložitJako" #: lazarusidestrconsts:liskmsaveall msgid "SaveAll" msgstr "UložitVše" #: lazarusidestrconsts:lisdiscardchanges msgid "Discard changes" msgstr "Zahodit změny" #: lazarusidestrconsts:lisdonotclosetheproject msgid "Do not close the project" msgstr "Nezavírat projekt" #: lazarusidestrconsts:lisdonotclosetheide msgid "Do not close the IDE" msgstr "Nezavírat IDE" #: lazarusidestrconsts:lismenusaveas msgid "Save As ..." msgstr "Uložit jako..." #: lazarusidestrconsts:lismenusaveall msgid "Save All" msgstr "Uložit vše" #: lazarusidestrconsts:lismenuclose msgid "Close" msgstr "Zavřít" #: lazarusidestrconsts:lispldonlyexistingfiles msgid "Only existing files" msgstr "Pouze existující soubory" #: lazarusidestrconsts:lispldshowgloballinks msgid "Show global links" msgstr "Ukázat celkové odkazy" #: lazarusidestrconsts:lispldshowuserlinks msgid "Show user links" msgstr "Ukázat uživatelské odkazy" #: lazarusidestrconsts:lispldglobal msgid "Global" msgstr "Celkový" #: lazarusidestrconsts:liskmcloseall msgid "Close All" msgstr "Zavřít vše" #: lazarusidestrconsts:lisctdefdefinetemplates msgid "Define templates" msgstr "Definovat šablony" #: lazarusidestrconsts:lismenucloseall msgid "Close all editor files" msgstr "Zavřít všechny editované soubory" #: lazarusidestrconsts:lismenucleandirectory msgid "Clean directory ..." msgstr "Vyčistit adresář..." #: lazarusidestrconsts:lismenuquit msgid "Quit" msgstr "Ukončit" #: lazarusidestrconsts:lismenurestart msgid "Restart" msgstr "Restartovat" #: lazarusidestrconsts:lismenuundo msgid "Undo" msgstr "Vrátit změnu" #: lazarusidestrconsts:lismenuredo msgid "Redo" msgstr "Opakovat změnu" #: lazarusidestrconsts:lismenucut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts:lismenucopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:lismenupaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts:lismenuindentselection msgid "Indent selection" msgstr "Odsadit výběr" #: lazarusidestrconsts:lismenuunindentselection msgid "Unindent selection" msgstr "Vrátit odsazení výběru" #: lazarusidestrconsts:lismenuuppercaseselection msgid "Uppercase selection" msgstr "Změnit výběr na velká písmena" #: lazarusidestrconsts:lismenulowercaseselection msgid "Lowercase selection" msgstr "Změnit výběr na malá písmena" #: lazarusidestrconsts:lismenutabstospacesselection msgid "Tabs to spaces in selection" msgstr "" #: lazarusidestrconsts:lismenuencloseselection msgid "Enclose selection ..." msgstr "Obklopit výběr" #: lazarusidestrconsts:lismenucommentselection msgid "Comment selection" msgstr "Zakomentovat výběr" #: lazarusidestrconsts:lismenuuncommentselection msgid "Uncomment selection" msgstr "Odkomentovat výběr" #: lazarusidestrconsts:liskminsertifdef msgid "Insert $IFDEF" msgstr "Vložit $IFDEF" #: lazarusidestrconsts:lismenuconditionalselection msgid "Insert $IFDEF..." msgstr "Vložit IFDEF..." #: lazarusidestrconsts:lismenusortselection msgid "Sort selection ..." msgstr "Seřadit výběr" #: lazarusidestrconsts:lismenubeaklinesinselection msgid "Break Lines in selection" msgstr "Ukončit žádky ve výběru" #: lazarusidestrconsts:liskmselectwordleft msgid "Select word left" msgstr "Vybrat slovo nalevo" #: lazarusidestrconsts:liskmselectwordright msgid "Select word right" msgstr "Vybrat slovo napravo" #: lazarusidestrconsts:liskmselectlinestart msgid "Select line start" msgstr "Vybrat k začátku řádku" #: lazarusidestrconsts:liskmselectlineend msgid "Select line end" msgstr "Vybrat ke konci řádku" #: lazarusidestrconsts:liskmselectpagetop msgid "Select page top" msgstr "Vybrat po začátek stránky" #: lazarusidestrconsts:liskmselectpagebottom msgid "Select page bottom" msgstr "Vybrat po konec stránky" #: lazarusidestrconsts:lismenuselect msgid "Select" msgstr "Vybrat" #: lazarusidestrconsts:lismenuselectall msgid "Select all" msgstr "Vybrat vše" #: lazarusidestrconsts:lissamabstractmethodsnotyetoverridden msgid "Abstract methods - not yet overridden" msgstr "Abstraktní metody - doposud nepředefinováno" #: lazarusidestrconsts:lismenuselecttobrace msgid "Select to brace" msgstr "Vybrat po závorku" #: lazarusidestrconsts:lismenuselectcodeblock msgid "Select code block" msgstr "Vybrat blok kódu" #: lazarusidestrconsts:lismenuselectword msgid "Select word" msgstr "Vybrat slovo" #: lazarusidestrconsts:lismenuselectline msgid "Select line" msgstr "Vybrat řádek" #: lazarusidestrconsts:lismenuselectparagraph msgid "Select paragraph" msgstr "Vybrat odstavec" #: lazarusidestrconsts:lismenuinsertcharacter msgid "Insert from Character Map" msgstr "Vložit z mapy znaků" #: lazarusidestrconsts:lismenuinserttext msgid "Insert text" msgstr "Vložit text" #: lazarusidestrconsts:lismenuinsertcvskeyword msgid "CVS keyword" msgstr "Klíčové slovo CVS" #: lazarusidestrconsts:lismenuinsertgeneral msgid "General" msgstr "Obecné" #: lazarusidestrconsts:lisnone2 msgid "none" msgstr "žádné" #: lazarusidestrconsts:lisor msgid "or" msgstr "nebo" #: lazarusidestrconsts:lisnone msgid "%snone" msgstr "%sžádný" #: lazarusidestrconsts:lisunitpaths msgid "Unit paths" msgstr "Cesty jednotky" #: lazarusidestrconsts:lisincludepaths msgid "Include paths" msgstr "Cesty pro začleněné soubory" #: lazarusidestrconsts:lissourcepaths msgid "Source paths" msgstr "Zdrojové cesty" #: lazarusidestrconsts:lismenucompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts:lismenuextractproc msgid "Extract procedure ..." msgstr "Vyjmout proceduru..." #: lazarusidestrconsts:lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Najít odkazy na identifikátor" #: lazarusidestrconsts:lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Přejmenovat identifikátor" #: lazarusidestrconsts:lismenuinsertgplnotice msgid "GPL notice" msgstr "Poznámka GPL" #: lazarusidestrconsts:lismenuinsertlgplnotice msgid "LGPL notice" msgstr "Poznámka LGPL" #: lazarusidestrconsts:lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" msgstr "Poznámka k upravené LGPL" #: lazarusidestrconsts:lismenuinsertusername msgid "Current username" msgstr "Aktuální uživatelské jméno" #: lazarusidestrconsts:lismenuinsertdatetime msgid "Current date and time" msgstr "Aktuální datum a čas" #: lazarusidestrconsts:lismenuinsertchangelogentry msgid "ChangeLog entry" msgstr "Položka Poznámek k vydání" #: lazarusidestrconsts:lismenufind msgid "Find" msgstr "Najít" #: lazarusidestrconsts:lismenufindnext msgid "Find &Next" msgstr "Najít &Další" #: lazarusidestrconsts:lismenufind2 msgid "&Find ..." msgstr "&Hledat..." #: lazarusidestrconsts:lismenufindprevious msgid "Find &Previous" msgstr "Najít &Předchozí" #: lazarusidestrconsts:lismenufindinfiles msgid "Find &in files ..." msgstr "Najít &v souborech..." #: lazarusidestrconsts:lismenureplace msgid "Replace" msgstr "Nahradit" #: lazarusidestrconsts:lismenuincrementalfind msgid "Incremental Find" msgstr "Přírůstkové hledání" #: lazarusidestrconsts:lismenureplace2 msgid "&Replace ..." msgstr "&Nahradit..." #: lazarusidestrconsts:lismenugotoline msgid "Goto line ..." msgstr "Přejít na řádek..." #: lazarusidestrconsts:lismenujumpback msgid "Jump back" msgstr "Skočit zpět" #: lazarusidestrconsts:lismenujumpforward msgid "Jump forward" msgstr "Skočit vpřed" #: lazarusidestrconsts:lismenuaddjumppointtohistory msgid "Add jump point to history" msgstr "Přidat bod skoku do historie" #: lazarusidestrconsts:lismenuviewjumphistory msgid "View Jump-History ..." msgstr "Zobrazit historii skoků..." #: lazarusidestrconsts:lismenufindblockotherendofcodeblock msgid "Find other end of code block" msgstr "Najít jiný konec bloku kódu" #: lazarusidestrconsts:lismenufindcodeblockstart msgid "Find code block start" msgstr "Najít začátek bloku kód" #: lazarusidestrconsts:lismenufinddeclarationatcursor msgid "Find Declaration at cursor" msgstr "Najít deklaraci na pozici kurzoru" #: lazarusidestrconsts:lismenuopenfilenameatcursor msgid "Open filename at cursor" msgstr "Otevřít jméno souboru na pozici kurzoru" #: lazarusidestrconsts:lismenugotoincludedirective msgid "Goto include directive" msgstr "Jít na směrnici pro zahrnutí souboru" #: lazarusidestrconsts:lismenujumptonexterror msgid "Jump to next error" msgstr "Skočit na následující chybu" #: lazarusidestrconsts:lismenujumptopreverror msgid "Jump to previous error" msgstr "Skočit na předchozí chybu" #: lazarusidestrconsts:lismenusetfreebookmark msgid "Set a free bookmark" msgstr "Nastavit volnou záložku" #: lazarusidestrconsts:lismenujumptonextbookmark msgid "Jump to next bookmark" msgstr "Skočit na další značku" #: lazarusidestrconsts:lismenujumptoprevbookmark msgid "Jump to previous bookmark" msgstr "Skočit na předchozí značku" #: lazarusidestrconsts:lismenuviewobjectinspector msgid "Object Inspector" msgstr "Inspektor objektů" #: lazarusidestrconsts:lismenuviewsourceeditor msgid "Source Editor" msgstr "Editor zdrojového kódu" #: lazarusidestrconsts:lismenuviewcodeexplorer msgid "Code Explorer" msgstr "Prohlížeč kódu" #: lazarusidestrconsts:lismenuviewcodebrowser msgid "Code Browser" msgstr "Prohlížeč kódu" #: lazarusidestrconsts:lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "Prohlížeč omezení" #: lazarusidestrconsts:lismenuviewcomponents msgid "&Components" msgstr "&Komponenty" #: lazarusidestrconsts:lismenujumpto msgid "Jump to" msgstr "Skočit na" #: lazarusidestrconsts:lismenuviewunits msgid "Units..." msgstr "Jednotky..." #: lazarusidestrconsts:lismenuviewforms msgid "Forms..." msgstr "Formuláře..." #: lazarusidestrconsts:lismenuviewunitdependencies msgid "View Unit Dependencies" msgstr "Zobrazit závislosti jednotky" #: lazarusidestrconsts:liskmviewunitinfo msgid "View Unit Info" msgstr "Zobrazit informace o jednotce" #: lazarusidestrconsts:lismenuviewunitinfo msgid "View Unit Information" msgstr "Zobrazit informace o jednotkách" #: lazarusidestrconsts:lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Změnit zobrazení forumář/jednotka" #: lazarusidestrconsts:lismenuviewmessages msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" msgstr "Zkopírovat vybraná hlášení do schránky" #: lazarusidestrconsts:liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" msgstr "Zkopírovat všechny zprávy do schránky" #: lazarusidestrconsts:liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" msgstr "Zkopírovat všechny a skryté zprávy do schránky" #: lazarusidestrconsts:lissaveallmessagestofile msgid "Save all messages to file" msgstr "Uložit všechna hlášení do souboru" #: lazarusidestrconsts:lismvdocking msgid "Docking" msgstr "Dokování" #: lazarusidestrconsts:lismenuviewsearchresults msgid "Search Results" msgstr "Výsledky hledání" #: lazarusidestrconsts:lissearchagain msgid "Search again" msgstr "Hledat znovu" #: lazarusidestrconsts:lissrclosepage msgid "Close page" msgstr "Zavřít stránku" #: lazarusidestrconsts:lismenuviewanchoreditor msgid "View Anchor Editor" msgstr "Zobrazit editor kotev" #: lazarusidestrconsts:liskmtoggleviewcomponentpalette msgid "Toggle view component palette" msgstr "Přepnout zobrazení palety komponent" #: lazarusidestrconsts:lismenuviewcomponentpalette msgid "View Component Palette" msgstr "Zobrazit sadu komponent" #: lazarusidestrconsts:lismenuviewtodolist msgid "ToDo List" msgstr "Seznam úkolů" #: lazarusidestrconsts:lismenuviewidespeedbuttons msgid "View IDE speed buttons" msgstr "Zobrazit rychlé tlačítka IDE" #: lazarusidestrconsts:lismenudebugwindows msgid "Debug windows" msgstr "Ladící okna" #: lazarusidestrconsts:lismenuviewwatches msgid "Watches" msgstr "Sledování" #: lazarusidestrconsts:lismenuviewbreakpoints msgid "BreakPoints" msgstr "Body přerušení" #: lazarusidestrconsts:lismenuviewlocalvariables msgid "Local Variables" msgstr "Místní proměnné" #: lazarusidestrconsts:lismenuviewcallstack msgid "Call Stack" msgstr "Zásobník volání" #: lazarusidestrconsts:lismenuviewdebugoutput msgid "Debug output" msgstr "Ladící výstup" #: lazarusidestrconsts:lismenuideinternals msgid "IDE internals" msgstr "Vnitřek IDE" #: lazarusidestrconsts:lismenupackagelinks msgid "Package links ..." msgstr "Odkazy balíčku..." #: lazarusidestrconsts:lismenunewproject msgid "New Project ..." msgstr "Nový projekt..." #: lazarusidestrconsts:lismenunewprojectfromfile msgid "New Project from file ..." msgstr "Nový projekt ze souboru..." #: lazarusidestrconsts:lismenuopenproject msgid "Open Project ..." msgstr "Otevřít projekt..." #: lazarusidestrconsts:lismenucloseproject msgid "Close Project" msgstr "Zavřít projekt" #: lazarusidestrconsts:lismenuopenrecentproject msgid "Open Recent Project ..." msgstr "Otevřít nedávný projekt..." #: lazarusidestrconsts:lismenusaveproject msgid "Save Project" msgstr "Uložit projekt" #: lazarusidestrconsts:lismenusaveprojectas msgid "Save Project As ..." msgstr "Uložit projekt jako..." #: lazarusidestrconsts:lismenupublishproject msgid "Publish Project ..." msgstr "Vydat projekt..." #: lazarusidestrconsts:lismenuprojectinspector msgid "Project Inspector" msgstr "Inspektor projektu" #: lazarusidestrconsts:liskmaddactiveunittoproject msgid "Add active unit to project" msgstr "Přidat aktivní jednotku do projektu" #: lazarusidestrconsts:liskmremoveactiveunitfromproject msgid "Remove active unit from project" msgstr "Odstranit aktivní jednotku z projektu" #: lazarusidestrconsts:liskmviewprojectsource msgid "View project source" msgstr "Zobrazit zdroj projektu" #: lazarusidestrconsts:lismenuaddtoproject msgid "Add editor file to Project" msgstr "Přidat editovaný soubor do projektu" #: lazarusidestrconsts:lismenuremovefromproject msgid "Remove from Project ..." msgstr "Odebrat z projektu..." #: lazarusidestrconsts:lismenuviewsource msgid "&View Source" msgstr "&Zobrazení zdroje" #: lazarusidestrconsts:lismenuprojectoptions msgid "Project Options ..." msgstr "Volby projektu ..." #: lazarusidestrconsts:lismenubuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts:lisbfbuildcommand msgid "Build Command" msgstr "Sestavit povel" #: lazarusidestrconsts:lismenubuildall msgid "Build all" msgstr "Sestavit vše" #: lazarusidestrconsts:lismenuquickcompile msgid "Quick compile" msgstr "Rychlý překlad" #: lazarusidestrconsts:lismenuabortbuild msgid "Abort Build" msgstr "Přerušit sestavení" #: lazarusidestrconsts:lismenuprojectrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts:lisbfalwaysbuildbeforerun msgid "Always Build before Run" msgstr "Vždy sestavit před spuštěním" #: lazarusidestrconsts:lisbfworkingdirectoryleaveemptyforfilepath2 msgid "Working Directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts:lisbfruncommand msgid "Run Command" msgstr "Spustit příkaz" #: lazarusidestrconsts:lismenupause msgid "Pause" msgstr "Pozastavit" #: lazarusidestrconsts:lismenustepinto msgid "Step into" msgstr "Vejít do" #: lazarusidestrconsts:lismenustepover msgid "Step over" msgstr "Přejít přes" #: lazarusidestrconsts:lismenuruntocursor msgid "Run to cursor" msgstr "Spustit po ukazatel" #: lazarusidestrconsts:liskmstopprogram msgid "Stop program" msgstr "Zastavit program" #: lazarusidestrconsts:lismenustop msgid "Stop" msgstr "Zastavit" #: lazarusidestrconsts:liscontinue msgid "Continue" msgstr "Pokračovat" #: lazarusidestrconsts:lismenuresetdebugger msgid "Reset debugger" msgstr "Resetovat ladící nástroj" #: lazarusidestrconsts:liskmcompileroptions msgid "Compiler options" msgstr "Volby překladače" #: lazarusidestrconsts:lismenucompileroptions msgid "Compiler Options ..." msgstr "Volby překladače ..." #: lazarusidestrconsts:lismenurunparameters msgid "Run Parameters ..." msgstr "Spustit s parametry..." #: lazarusidestrconsts:lismenubuildfile msgid "Build File" msgstr "Sestavit soubor" #: lazarusidestrconsts:lismenurunfile msgid "Run File" msgstr "Spustit soubor" #: lazarusidestrconsts:liskmconfigbuildfile msgid "Config %sBuild File%s" msgstr "Konfigurace %sSoubor sestavení %s" #: lazarusidestrconsts:liskminspect msgid "Inspect" msgstr "Zkoumat" #: lazarusidestrconsts:liskmevaluatemodify msgid "Evaluate/Modify" msgstr "Vyhodnocení/Upravení" #: lazarusidestrconsts:liskmaddwatch msgid "Add watch" msgstr "Přidat sledování" #: lazarusidestrconsts:lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Nastavit soubor pro Sestavitení+Spuštění..." #: lazarusidestrconsts:lismenuinspect msgid "Inspect ..." msgstr "Zkoumat..." #: lazarusidestrconsts:lismenuevaluate msgid "Evaluate/Modify ..." msgstr "Vyhodnocení/Upravení..." #: lazarusidestrconsts:lismenuaddwatch msgid "Add watch ..." msgstr "Přidat sledování ..." #: lazarusidestrconsts:lismenuaddbreakpoint msgid "Add breakpoint" msgstr "Přidat bod přerušení" #: lazarusidestrconsts:lismenuaddbpsource msgid "Source breakpoint" msgstr "Zdrojový bod přerušení" #: lazarusidestrconsts:lismenunewpackage msgid "New package ..." msgstr "Nový balíček..." #: lazarusidestrconsts:lismenuopenpackage msgid "Open loaded package ..." msgstr "Otevřít načtený balíček..." #: lazarusidestrconsts:lismenuopenrecentpkg msgid "Open recent package ..." msgstr "Otevřít nedávný balíček..." #: lazarusidestrconsts:lismenuopenpackagefile msgid "Open package file (.lpk) ..." msgstr "Otevřít soubor balíčku (.lpk)..." #: lazarusidestrconsts:lismenuopenpackageofcurunit msgid "Open package of current unit" msgstr "Otevřít balíček aktuální jednotky" #: lazarusidestrconsts:lismenuaddcurunittopkg msgid "Add active unit to a package" msgstr "Přidat aktivní jednotku do balíčku" #: lazarusidestrconsts:liskmpackagegraph msgid "Package graph" msgstr "Graf balíčku" #: lazarusidestrconsts:liskmconfigureinstalledpackages msgid "Configure installed packages" msgstr "Konfigurovat instalované balíčky" #: lazarusidestrconsts:liskmconfigurecustomcomponents msgid "Configure custom components" msgstr "Konfigurovat vlastní komponenty" #: lazarusidestrconsts:lismenupackagegraph msgid "Package Graph ..." msgstr "Graf balíčku..." #: lazarusidestrconsts:lismenueditinstallpkgs msgid "Configure installed packages ..." msgstr "Konfigurovat instalované balíčky..." #: lazarusidestrconsts:lismenuconfigcustomcomps msgid "Configure custom components ..." msgstr "Konfigurovat vlastní komponenty..." #: lazarusidestrconsts:lismenusettings msgid "Configure custom tools ..." msgstr "Konfigurovat vlastní nástroje..." #: lazarusidestrconsts:lismenuquicksyntaxcheck msgid "Quick syntax check" msgstr "Rychlá kontrola syntaxe" #: lazarusidestrconsts:lismenuguessunclosedblock msgid "Guess unclosed block" msgstr "Odhadnout neuzavřený blok" #: lazarusidestrconsts:lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" msgstr "Odhadnout chybně umístěný IFDEF/ENDIF" #: lazarusidestrconsts:lismenumakeresourcestring msgid "Make Resource String ..." msgstr "Vytvořit zdrojový řetězec..." #: lazarusidestrconsts:lismenudiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts:lismenuconvertdfmtolfm msgid "Convert DFM file to LFM ..." msgstr "Převést DFM soubor na LFM ..." #: lazarusidestrconsts:lismenuchecklfm msgid "Check LFM file in editor" msgstr "Zkontrolovat soubor LFM v editoru" #: lazarusidestrconsts:lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Převést Delphi jednotku na Lazarus jednotku ..." #: lazarusidestrconsts:lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." msgstr "Převést Delphi projekt na Lazarus projekt ..." #: lazarusidestrconsts:lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." msgstr "Převést Delphi balíček na Lazarus balíček ..." #: lazarusidestrconsts:lismenubuildlazarus msgid "Build Lazarus" msgstr "Sestavit Lazarus" #: lazarusidestrconsts:lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Nastavení \"Sestavení Lazarusu\" ..." #: lazarusidestrconsts:lismenugeneraloptions msgid "Environment options ..." msgstr "Volby prostředí..." #: lazarusidestrconsts:lismenueditoroptions msgid "Editor options ..." msgstr "Nastavení editoru ..." #: lazarusidestrconsts:lismenueditcodetemplates msgid "Code Templates ..." msgstr "Šablony kódu..." #: lazarusidestrconsts:lismendebuggeroptions msgid "Debugger Options ..." msgstr "Nastavení ladícího nástroje..." #: lazarusidestrconsts:lismenucodetoolsoptions msgid "CodeTools Options ..." msgstr "Nastavení CodeTools..." #: lazarusidestrconsts:lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." msgstr "Editor definic pro CodeTools..." #: lazarusidestrconsts:lismenuonlinehelp msgid "Online Help" msgstr "Online nápověda" #: lazarusidestrconsts:lismenureportingbug msgid "Reporting a bug..." msgstr "Nahlásit závadu..." #: lazarusidestrconsts:lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts:liskmconfigurehelp msgid "Configure Help" msgstr "Nastavit nápovědu" #: lazarusidestrconsts:liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "Kontextová nápověda" #: lazarusidestrconsts:liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts:lismenuconfigurehelp msgid "Configure Help ..." msgstr "Nastavit nápovědu..." #: lazarusidestrconsts:lismenucontexthelp msgid "Context sensitive Help" msgstr "Kontextová nápověda" #: lazarusidestrconsts:lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts:lismenucreatefpdocfiles msgid "Create FPDoc files" msgstr "Vytvořit soubory FPDoc" #: lazarusidestrconsts:lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Zkopírovat vybrané komponenty do schránky" #: lazarusidestrconsts:lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Výjmout vybrané komponenty do schránky" #: lazarusidestrconsts:lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Vložit vybrané komponenty ze schránky" #: lazarusidestrconsts:lisdsgselectparentcomponent msgid "Select parent component" msgstr "Vybrat rodičovskou komponentu" #: lazarusidestrconsts:lisdsgordermovetofront msgid "Move component to front" msgstr "Přesunout komponentu dopředu" #: lazarusidestrconsts:lisdsgordermovetoback msgid "Move component to back" msgstr "Přesunout komponentu dozadu" #: lazarusidestrconsts:lisdsgorderforwardone msgid "Move component one forward" msgstr "Přesunout komponentru o jedno dopředu" #: lazarusidestrconsts:lisdsgorderbackone msgid "Move component one back" msgstr "Přesunout komponentu o jedno dozadu" #: lazarusidestrconsts:lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Vyberte zdrojový soubor programu (*.pp,*.pas,*.lpr)" #: lazarusidestrconsts:lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "Zdrojový soubor programu musí mít pascalovkou příponu jako .pas, .pp nebo .lpr" #: lazarusidestrconsts:liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "Volby překladače pro projekt %s" #: lazarusidestrconsts:lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Vyberte jednotku Delphi (*.pas)" #: lazarusidestrconsts:lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "Vyberte projekt Delphi (*.dpr)" #: lazarusidestrconsts:lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "Vyberte balíček Delphi (.dpk)" #: lazarusidestrconsts:lisdelphiproject msgid "Delphi project" msgstr "Projekt Delphi" #: lazarusidestrconsts:lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" msgstr "Nelze číst soubor %s%s%s%sChyba: %s" #: lazarusidestrconsts:lisformaterror msgid "Format error" msgstr "Chyba formátování" #: lazarusidestrconsts:lislfmfilecorrupt msgid "LFM file corrupt" msgstr "Poškozený soubor LFM" #: lazarusidestrconsts:lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" msgstr "Nelze najít platné jméno třídy v %s%s%s" #: lazarusidestrconsts:lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" msgstr "Nelze převést soubor %s%s%s%sChyba: %s" #: lazarusidestrconsts:lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" msgstr "Nelze zapisovat do souboru %s%s%s%sChyba: %s" #: lazarusidestrconsts:liserrorcreatinglrs msgid "Error creating lrs" msgstr "Chyba vytváření lrs" #: lazarusidestrconsts:lislfmfilenotfound msgid "LFM file not found" msgstr "Soubor LFM nenalezen" #: lazarusidestrconsts:listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." msgstr "Následující jednotky nebyly nalezeny:%s%s%s%s1) Buď nejsou tyto jednotky v cestě jednotek, potom můžete" #: lazarusidestrconsts:lisunitnotfound msgid "Unit not found" msgstr "Jednotka nenalezena" #: lazarusidestrconsts:lisunitsnotfound2 msgid "Units not found" msgstr "Jednotka nenalezena" #: lazarusidestrconsts:lisunitlfmfile msgid "Unit: %s%sLFM file: %s" msgstr "Jednotka: %s%ssoubor LFM: %s" #: lazarusidestrconsts:lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." msgstr "Nelze převést soubor lfm na lrs a zapsat lrs." #: lazarusidestrconsts:lisnotadelphiproject msgid "Not a Delphi project" msgstr "Není projekt Delphi" #: lazarusidestrconsts:listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" msgstr "Soubor %s%s%s není Delphi projekt." #: lazarusidestrconsts:lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." msgstr "Nelze načíst starý soubor zdrojů.%sSoubor zdrojů je první vkládaný soubor v inicializační části %s.Na příklad {$I %s.lrs}.%sPravděpodobně chyba syntaxe." #: lazarusidestrconsts:lisresourceloaderror msgid "Resource load error" msgstr "" #: lazarusidestrconsts:lisignoremissingfile msgid "Ignore missing file" msgstr "" #: lazarusidestrconsts:lisnoname msgid "noname" msgstr "" #: lazarusidestrconsts:listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." msgstr "" #: lazarusidestrconsts:lisrenamefile msgid "Rename file?" msgstr "" #: lazarusidestrconsts:listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "" #: lazarusidestrconsts:lisrenametolowercase msgid "Rename to lowercase" msgstr "" #: lazarusidestrconsts:liskeepname msgid "Keep name" msgstr "" #: lazarusidestrconsts:lisoverwritefile msgid "Overwrite file?" msgstr "" #: lazarusidestrconsts:lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Soubor %s%s%s už existuje.%sNahradit?" #: lazarusidestrconsts:lisoverwritefileondisk msgid "Overwrite file on disk" msgstr "Přepsat soubor na disku" #: lazarusidestrconsts:lisambiguousfilesfound msgid "Ambiguous files found" msgstr "Nejednoznačné soubory nalezeny" #: lazarusidestrconsts:listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "V adresáři jsou další soubory se stejným jménem, %skteré se liší pouze ve velikosti písmen:%s%s%sSmazat je?" #: lazarusidestrconsts:lisdeleteoldfile msgid "Delete old file %s%s%s?" msgstr "Odstranit starý soubor %s%s%s?" #: lazarusidestrconsts:lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." msgstr "Odstranění souboru %s%s%s selhalo." #: lazarusidestrconsts:lisstreamingerror msgid "Streaming error" msgstr "Chyba proudového zpracování" #: lazarusidestrconsts:lisunabletostreamt msgid "Unable to stream %s:T%s." msgstr "" #: lazarusidestrconsts:lisresourcesaveerror msgid "Resource save error" msgstr "" #: lazarusidestrconsts:lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts:lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts:lisunabletocreatefile2 msgid "Unable to create file %s%s%s" msgstr "Nelze vytvořit soubor %s%s%s" #: lazarusidestrconsts:liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Pokračovat bez načtení formuláře" #: lazarusidestrconsts:liscancelloadingunit msgid "Cancel loading unit" msgstr "Zrušit načítání jednotky" #: lazarusidestrconsts:lisabortallloading msgid "Abort all loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts:lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "Nelze převést komponentu v binárním proudu %s:T%s na text." #: lazarusidestrconsts:listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "" #: lazarusidestrconsts:lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "Přeskočit soubor a pokračovat v načítání" #: lazarusidestrconsts:lisabortloadingproject msgid "Abort loading project" msgstr "Přerušit načítání projektu" #: lazarusidestrconsts:lisfilenotfound2 msgid "File %s%s%s not found.%s" msgstr "Soubor %s%s%s nenalezen.%s" #: lazarusidestrconsts:lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" msgstr "Soubor %s%s%s nenalezen.%sChcete jej vytvořit?%s" #: lazarusidestrconsts:lisprojectinfofiledetected msgid "Project info file detected" msgstr "Zjištěn informační soubor projektu" #: lazarusidestrconsts:listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." msgstr "Soubor %s vypadá, že je programový soubor existujícícho projektu Lazarusu." #: lazarusidestrconsts:listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "" #: lazarusidestrconsts:lisprogramdetected msgid "Program detected" msgstr "" #: lazarusidestrconsts:lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgstr "" #: lazarusidestrconsts:lisformloaderror msgid "Form load error" msgstr "Chyba načtení formuláře" #: lazarusidestrconsts:lissaveprojectlpi msgid "Save Project %s (*.lpi)" msgstr "Uložit projekt %s (*.lpi)" #: lazarusidestrconsts:lisinvalidprojectfilename msgid "Invalid project filename" msgstr "Neplatné jméno projektu" #: lazarusidestrconsts:lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s je chybné jméno projektu.%sProsím vyberte jiné (např. project1.lpi)" #: lazarusidestrconsts:listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." msgstr "Jméno %s%s%s není platný pascalovský identifikátor." #: lazarusidestrconsts:lischooseadifferentname msgid "Choose a different name" msgstr "Vyberte jiné jméno" #: lazarusidestrconsts:listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" msgstr "" #: lazarusidestrconsts:lisunitidentifierexists msgid "Unit identifier exists" msgstr "Identifikátor jednotky již existuje" #: lazarusidestrconsts:listhereisaunitwiththenameintheprojectpleasechoose msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgstr "" #: lazarusidestrconsts:liserrorcreatingfile msgid "Error creating file" msgstr "Chyba vytváření souboru" #: lazarusidestrconsts:lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" msgstr "" #: lazarusidestrconsts:liscopyerror2 msgid "Copy error" msgstr "Chyba kopírování" #: lazarusidestrconsts:lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." msgstr "" #: lazarusidestrconsts:lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." msgstr "Nelze vytvořit adresář %s%s%s." #: lazarusidestrconsts:lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" msgstr "Nelze zkopírovat soubor %s%s%s%sna %s%s%s" #: lazarusidestrconsts:lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "Omlouváme se, tento typ ještě nebyl implementován." #: lazarusidestrconsts:lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" msgstr "Soubor %s%s%s byl pozměněn. Uložit?" #: lazarusidestrconsts:lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" msgstr "Jednotka %s%s%s byla změněna. Uložit?" #: lazarusidestrconsts:lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts:lissourcemodified msgid "Source modified" msgstr "" #: lazarusidestrconsts:lisopenproject msgid "Open Project?" msgstr "Otevřít projekt?" #: lazarusidestrconsts:lisopentheproject msgid "Open the project %s?" msgstr "Otevřít projekt %s?" #: lazarusidestrconsts:lisopenpackage msgid "Open Package?" msgstr "Otevřít balíček?" #: lazarusidestrconsts:lisopenthepackage msgid "Open the package %s?" msgstr "Otevřít balíček %s?" #: lazarusidestrconsts:lisrevertfailed msgid "Revert failed" msgstr "Vrácení selhalo" #: lazarusidestrconsts:lisfileisvirtual msgid "File %s%s%s is virtual." msgstr "Soubor %s%s%s je virtuální." #: lazarusidestrconsts:lisunabletowrite msgid "Unable to write %s%s%s%s%s." msgstr "Nelze zapisovat %s%s%s%s%s." #: lazarusidestrconsts:lisfilenottext msgid "File not text" msgstr "Soubor není textový" #: lazarusidestrconsts:lisunabletorenamefile msgid "Unable to rename file" msgstr "Soubor nelze přejmenovat" #: lazarusidestrconsts:lisunabletocopyfile msgid "Unable to copy file" msgstr "Soubor nelze zkopírovat" #: lazarusidestrconsts:lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "" #: lazarusidestrconsts:lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?" #: lazarusidestrconsts:lisinvalidcommand msgid "Invalid command" msgstr "Neplatný povel" #: lazarusidestrconsts:listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." msgstr "" #: lazarusidestrconsts:lisinvaliddestinationdirectory msgid "Invalid destination directory" msgstr "Neplatný cílový adresář" #: lazarusidestrconsts:lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "Cílová složka %s%s%s je neplatná.%sProsím vyberte a celou cestu." #: lazarusidestrconsts:lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "" #: lazarusidestrconsts:liscommandafterinvalid msgid "Command after invalid" msgstr "" #: lazarusidestrconsts:listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgstr "" #: lazarusidestrconsts:liscommandafterpublishingmodule msgid "Command after publishing module" msgstr "" #: lazarusidestrconsts:lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "" #: lazarusidestrconsts:lisaddtoproject msgid "Add %s to project?" msgstr "Přidat %s do projektu?" #: lazarusidestrconsts:listhefile msgid "The file %s%s%s" msgstr "Soubor %s%s%s" #: lazarusidestrconsts:lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "Přidat do vyhledávací cesty jednotek" #: lazarusidestrconsts:listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts:lisisalreadypartoftheproject msgid "%s is already part of the Project." msgstr "%s už je částí projektu." #: lazarusidestrconsts:lisremovefromproject msgid "Remove from project" msgstr "Odstranit z projektu" #: lazarusidestrconsts:liscreateaprojectfirst msgid "Create a project first!" msgstr "Vytvořte nejdříve projekt!" #: lazarusidestrconsts:listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" msgstr "" #: lazarusidestrconsts:lisbuildnewproject msgid "Build new project" msgstr "Sestavit nový projekt" #: lazarusidestrconsts:listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgstr "" #: lazarusidestrconsts:lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built. :)" msgstr "Projekt %s%s%s úspěšně sestaven. :)" #: lazarusidestrconsts:lisexecutingcommandbefore msgid "Executing command before" msgstr "" #: lazarusidestrconsts:lisexecutingcommandafter msgid "Executing command after" msgstr "" #: lazarusidestrconsts:lisnoprogramfilesfound msgid "No program file %s%s%s found." msgstr "" #: lazarusidestrconsts:liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" msgstr "Chyba inicializace programu%s%s%s%s%sChyba: %s" #: lazarusidestrconsts:lisnotnow msgid "Not now" msgstr "Nyní ne" #: lazarusidestrconsts:lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." msgstr "Nemůžete sestavit lazarus v průběhu ladění nebo překládání." #: lazarusidestrconsts:lisunabletosavefile msgid "Unable to save file %s%s%s" msgstr "Soubor %s%s%s nelze uložit" #: lazarusidestrconsts:lisreaderror msgid "Read Error" msgstr "Chyba čtení" #: lazarusidestrconsts:lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" msgstr "" #: lazarusidestrconsts:liswriteerror msgid "Write Error" msgstr "Chyba zápisu" #: lazarusidestrconsts:lisunabletowritetofile msgid "Unable to write to file %s%s%s!" msgstr "" #: lazarusidestrconsts:lisfiledoesnotlooklikeatextfileopenitanyway2 msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?" #: lazarusidestrconsts:lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." msgstr "" #: lazarusidestrconsts:lisambiguousunitfound2 msgid "Ambiguous unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts:listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" msgstr "" #: lazarusidestrconsts:lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "" #: lazarusidestrconsts:lisignoreall msgid "Ignore all" msgstr "Ignorovat vše" #: lazarusidestrconsts:lisdeletefilefailed msgid "Delete file failed" msgstr "Odstranění souboru selhalo" #: lazarusidestrconsts:lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" msgstr "" #: lazarusidestrconsts:lisrenamefilefailed msgid "Rename file failed" msgstr "Přejmenování souboru selhalo" #: lazarusidestrconsts:lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts:lisbackupfilefailed msgid "Backup file failed" msgstr "Zálohování souboru selhalo" #: lazarusidestrconsts:lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts:lisfilenotlowercase msgid "File not lowercase" msgstr "Soubor není s malými písmeny" #: lazarusidestrconsts:listheunitisnotlowercasethefreepascalcompiler10xneeds msgid "The unit %s%s%s is not lowercase.%sThe FreePascal compiler 1.0.x needs lowercase filenames. If you do not use the fpc 1.0.x to compile this unit, you can ignore this message.%s%sRename file?" msgstr "" #: lazarusidestrconsts:lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "Odstranit nejednoznačný soubor?" #: lazarusidestrconsts:lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgstr "Nalezen nejednoznačný soubor: %s%s%s%sTento soubor může být chybě zaměněn za %s%s%s%s%sSmazat nejednoznačný soubor?" #: lazarusidestrconsts:lislazaruseditorv msgid "Lazarus IDE v%s" msgstr "" #: lazarusidestrconsts:lisnewproject msgid "%s - (new project)" msgstr "%s - (nový projekt)" #: lazarusidestrconsts:liscompiling msgid "%s (compiling ...)" msgstr "%s (kompilování ...)" #: lazarusidestrconsts:lisdebugging msgid "%s (debugging ...)" msgstr "%s (ladění ...)" #: lazarusidestrconsts:lisunabletofindfile msgid "Unable to find file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test" msgstr "" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "" #: lazarusidestrconsts:lisclassnotfound msgid "Class not found" msgstr "Třída nenalezena" #: lazarusidestrconsts:lisoifclassnotfound msgid "Class %s%s%s not found." msgstr "" #: lazarusidestrconsts:lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgstr "" #: lazarusidestrconsts:liscontrolneedsparent msgid "Control needs parent" msgstr "" #: lazarusidestrconsts:listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." msgstr "" #: lazarusidestrconsts:lisconversionerror msgid "Conversion error" msgstr "" #: lazarusidestrconsts:lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "" #: lazarusidestrconsts:lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "" #: lazarusidestrconsts:lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "" #: lazarusidestrconsts:lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "" #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." msgstr "" #: lazarusidestrconsts:lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "" #: lazarusidestrconsts:lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts:liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" msgstr "Jméno komponenty není platný identifikátor" #: lazarusidestrconsts:lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgstr "Zdvojené jméno: Komponenta pojmenovaná %s%s%s již existuje ve zděděné komponentě %s" #: lazarusidestrconsts:liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" msgstr "Jméno komponenty je klíčové slovo" #: lazarusidestrconsts:listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts:lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "" #: lazarusidestrconsts:lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "" #: lazarusidestrconsts:listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" msgstr "" #: lazarusidestrconsts:listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts:lisseemessages msgid "See messages." msgstr "" #: lazarusidestrconsts:liserror msgid "Error: " msgstr "Chyba:" #: lazarusidestrconsts:lissavechanges msgid "Save changes?" msgstr "" #: lazarusidestrconsts:lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgstr "" #: lazarusidestrconsts:lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "" #: lazarusidestrconsts:lissorrynotimplementedyet msgid "Sorry, not implemented yet" msgstr "" #: lazarusidestrconsts:lisunabletofindmethodpleasefixtheerrorshowninthemessage msgid "Unable to find method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisunabletocreatenewmethodpleasefixtheerrorshownin msgid "Unable to create new method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisunabletoshowmethodpleasefixtheerrorshowninthemessage msgid "Unable to show method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lismethodclassnotfound msgid "Method class not found" msgstr "Třída metody nenalezena" #: lazarusidestrconsts:lisclassofmethodnotfound msgid "Class %s%s%s of method %s%s%s not found." msgstr "" #: lazarusidestrconsts:lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts:lisstopdebugging msgid "Stop Debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts:lisstopthedebugging msgid "Stop the debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts:liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" msgstr "Nelze nalézt spouštěš lazarusu:%s%s" #: lazarusidestrconsts:lisinfobuildlines msgid "Lines:" msgstr "Řádky:" #: lazarusidestrconsts:lisinfobuilderrors msgid "Errors:" msgstr "Chyby:" #: lazarusidestrconsts:lisinfobuildhint msgid "Hints:" msgstr "Pokyny:" #: lazarusidestrconsts:lisinfobuildwarning msgid "Warnings:" msgstr "Varování:" #: lazarusidestrconsts:lisinfobuildbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:lisinfobuildcomplile msgid "Compiling..." msgstr "Překládání..." #: lazarusidestrconsts:lisinfobuilderror msgid "Error..." msgstr "Chyba..." #: lazarusidestrconsts:liscreatedirectory msgid "Create directory?" msgstr "Vytvořit adresář?" #: lazarusidestrconsts:listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." msgstr "" #: lazarusidestrconsts:liscreateit msgid "Create it" msgstr "" #: lazarusidestrconsts:lisinfobuildsuccess msgid "Success..." msgstr "Úspěch..." #: lazarusidestrconsts:lisinfobuildabort msgid "Aborted..." msgstr "Přerušeno..." #: lazarusidestrconsts:lisinfobuildcaption msgid "Compile Project" msgstr "Kompilovat projekt" #: lazarusidestrconsts:lisinfobuildmakeabort msgid "Abort" msgstr "Přerušit" #: lazarusidestrconsts:lisinfobuildnote msgid "Notes:" msgstr "Poznámky:" #: lazarusidestrconsts:lisresourcefilecomment msgid "This is an automatically generated lazarus resource file" msgstr "Toto je automaticky generovaný zdrojový soubor lazarusu" #: lazarusidestrconsts:lisopenfile msgid "Open file" msgstr "Otevřít soubor" #: lazarusidestrconsts:lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "Upravit virtuální jednotku" #: lazarusidestrconsts:lisiecoexportfileexists msgid "Export file exists" msgstr "Exportovaný soubor existuje" #: lazarusidestrconsts:lisiecoexportfileexistsopenfileandreplaceonlycompileropti msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts:lisiecoopenorloadcompileroptions msgid "Open or Load Compiler Options" msgstr "Otevřít nebo načíst nastavení překladače" #: lazarusidestrconsts:lisiecoerroraccessingxml msgid "Error accessing xml" msgstr "Chyba přistupování k xml" #: lazarusidestrconsts:lisiecoerrorloadingxml msgid "Error loading xml" msgstr "Chyba načítání xml" #: lazarusidestrconsts:lisiecoerrorloadingxmlfile msgid "Error loading xml file %s%s%s:%s%s" msgstr "Chyba načítání xml souboru %s%s%s:%s%s" #: lazarusidestrconsts:lisiecoerroraccessingxmlfile msgid "Error accessing xml file %s%s%s:%s%s" msgstr "Chyba přístupu k xml souboru %s%s%s:%s%s" #: lazarusidestrconsts:lisiecorecentfiles msgid "Recent files" msgstr "Nedávné soubory" #: lazarusidestrconsts:lisiecosavetorecent msgid "Save to recent" msgstr "Uložit do nedávných" #: lazarusidestrconsts:lisiecoopenrecent msgid "Open recent" msgstr "Otevřít nedávný" #: lazarusidestrconsts:lisiecosavetofile msgid "Save to file" msgstr "Uložit soubor" #: lazarusidestrconsts:lisiecoloadfromfile msgid "Load from file" msgstr "Načíst ze souboru" #: lazarusidestrconsts:lislazarusfile msgid "Lazarus File" msgstr "Soubor Lazarusu" #: lazarusidestrconsts:lispascalunit msgid "Pascal unit" msgstr "Pascalovský jednotka" #: lazarusidestrconsts:lispascalsourcefile msgid "Pascal source file" msgstr "Zdrojový soubor Pascalu" #: lazarusidestrconsts:lisfreepascalsourcefile msgid "FreePascal source file" msgstr "Zdrojový soubor Free Pascalu" #: lazarusidestrconsts:lisdebugunabletoloadfile msgid "Unable to load file" msgstr "Nelze načíst soubor" #: lazarusidestrconsts:lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." msgstr "Nelze načíst soubor %s%s%s." #: lazarusidestrconsts:lisopenprojectfile msgid "Open Project File" msgstr "Otevřít soubor projektu" #: lazarusidestrconsts:lislazarusprojectinfofile msgid "Lazarus Project Info file" msgstr "Informační soubor projektu Lazarusu" #: lazarusidestrconsts:lisallfiles msgid "All Files" msgstr "Všechny soubory" #: lazarusidestrconsts:lisexeprograms msgid "Programs" msgstr "Programy" #: lazarusidestrconsts:lisselectfile msgid "Select the file" msgstr "Vybrat soubor" #: lazarusidestrconsts:lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "K procházení souboru klikněte zde" #: lazarusidestrconsts:lisprojectwizard msgid "Project Wizard" msgstr "Průvodce projektu" #: lazarusidestrconsts:lisquitlazarus msgid "Quit Lazarus" msgstr "Ukončit Lazarus" #: lazarusidestrconsts:liscreatenewproject msgid "Create new project" msgstr "Vytvořit nový projekt" #: lazarusidestrconsts:lisopenpackagefile msgid "Open Package File" msgstr "Otevřít soubor projektu" #: lazarusidestrconsts:lissavespace msgid "Save " msgstr "Uložit" #: lazarusidestrconsts:lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Vybrat soubor formuláře Delphi (*.dfm)" #: lazarusidestrconsts:lischoosedirectory msgid "Choose directory" msgstr "Vyberte adresář" #: lazarusidestrconsts:lisdestinationdirectory msgid "Destination directory" msgstr "Cílová složka" #: lazarusidestrconsts:liscommandafter msgid "Command after" msgstr "" #: lazarusidestrconsts:lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "" #: lazarusidestrconsts:lischoosecompilerpath msgid "Choose compiler filename (%s)" msgstr "" #: lazarusidestrconsts:lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "" #: lazarusidestrconsts:lischoosemakepath msgid "Choose make path" msgstr "" #: lazarusidestrconsts:lischoosedebuggerpath msgid "Choose debugger filename" msgstr "" #: lazarusidestrconsts:lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "" #: lazarusidestrconsts:lislazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "Nastavení plochy Lazarusu" #: lazarusidestrconsts:lisxmlfiles msgid "XML files" msgstr "XML soubory" #: lazarusidestrconsts:lissavechangestoproject msgid "Save changes to project %s?" msgstr "Uložit změny projektu %s?" #: lazarusidestrconsts:lisprojectchanged msgid "Project changed" msgstr "Projekt změněn" #: lazarusidestrconsts:lisfpcsourcedirectoryerror msgid "FPC Source Directory error" msgstr "" #: lazarusidestrconsts:lispleasecheckthefpcsourcedirectory msgid "Please check the freepascal source directory" msgstr "" #: lazarusidestrconsts:liscompilererror msgid "Compiler error" msgstr "Chyba překladače" #: lazarusidestrconsts:lispleasecheckthecompilername msgid "Please check the compiler name" msgstr "Zkontrolujte prosím jméno překladače" #: lazarusidestrconsts:lisaboutlazarus msgid "About Lazarus" msgstr "O Lazarusu" #: lazarusidestrconsts:lisversion msgid "Version" msgstr "Verze" #: lazarusidestrconsts:lisvertoclipboard msgid "Copy version information to clipboard" msgstr "Zkopírovat informace o verzi do schránky" #: lazarusidestrconsts:lislogo msgid "Logo" msgstr "Logo" #: lazarusidestrconsts:lisdate msgid "Date" msgstr "Datum" #: lazarusidestrconsts:lisfpcversion msgid "FPC Version: " msgstr "Verze FPC:" #: lazarusidestrconsts:lissvnrevision msgid "SVN Revision: " msgstr "Revize SVN:" #: lazarusidestrconsts:lisclose msgid "&Close" msgstr "&Zavřít" #: lazarusidestrconsts:lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." msgstr "" #: lazarusidestrconsts:lisaboutnocontributors msgid "Cannot find contributors list." msgstr "Nelze nalézt seznam přispěvatelů." #: lazarusidestrconsts:lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "Jméno jednotky je už v projektu" #: lazarusidestrconsts:listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "" #: lazarusidestrconsts:lisforcerenaming msgid "Force renaming" msgstr "Vynutit přejmenování" #: lazarusidestrconsts:liscancelrenaming msgid "Cancel renaming" msgstr "Zrušit přejmenování" #: lazarusidestrconsts:lisabortall msgid "Abort all" msgstr "Přerušit vše" #: lazarusidestrconsts:lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "Neplatný Pascalovský identifikátor" #: lazarusidestrconsts:lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." msgstr "Jméno \"%s\" není platný pascalovský identifikátor." #: lazarusidestrconsts:liscopyerror msgid "Copy Error" msgstr "Chyba kopírování" #: lazarusidestrconsts:lishintopen msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts:lishintsave msgid "Save" msgstr "Uložit" #: lazarusidestrconsts:lishintsaveall msgid "Save all" msgstr "Uložit vše" #: lazarusidestrconsts:lishinttoggleformunit msgid "Toggle Form/Unit" msgstr "Přepni Formulář/Jednotka" #: lazarusidestrconsts:lishintviewunits msgid "View Units" msgstr "Zobrazit jednotky" #: lazarusidestrconsts:lishintviewforms msgid "View Forms" msgstr "Zobrazit formuláře" #: lazarusidestrconsts:lishintrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts:lishintpause msgid "Pause" msgstr "Pozastavit" #: lazarusidestrconsts:lishintstepinto msgid "Step Into" msgstr "Vejít do" #: lazarusidestrconsts:lishintstepover msgid "Step Over" msgstr "Přejít přes" #: lazarusidestrconsts:lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts:dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(podadresáře ne)" #: lazarusidestrconsts:dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" msgstr "" #: lazarusidestrconsts:dlgsearchcaption msgid "Searching..." msgstr "Hledání..." #: lazarusidestrconsts:dlgsearchabort msgid "Search terminated by user." msgstr "Hledání přerušeno uživatelem." #: lazarusidestrconsts:lissmatches msgid "Matches" msgstr "Odpovídá" #: lazarusidestrconsts:lisssearching msgid "Searching" msgstr "Hledání" #: lazarusidestrconsts:lisssearchtext msgid "Search text" msgstr "Hledat text" #: lazarusidestrconsts:dlgdesktop msgid "Desktop" msgstr "Plocha" #: lazarusidestrconsts:dlgwindow msgid "Window" msgstr "Okno" #: lazarusidestrconsts:dlgfrmeditor msgid "Form Editor" msgstr "Editor formuláře" #: lazarusidestrconsts:dlgobjinsp msgid "Object Inspector" msgstr "Inspektor objektů" #: lazarusidestrconsts:dlgenvfiles msgid "Files" msgstr "Soubory" #: lazarusidestrconsts:lisignorebinaries msgid "Ignore binaries" msgstr "Ignorovat binární" #: lazarusidestrconsts:lissimplesyntax msgid "Simple Syntax" msgstr "Jednoduchá syntaxe" #: lazarusidestrconsts:lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "" #: lazarusidestrconsts:lisuseexcludefilter msgid "Use Exclude Filter" msgstr "Použít filtr vyřazení" #: lazarusidestrconsts:lisexcludefilter msgid "Exclude Filter" msgstr "Filtr vyřazení" #: lazarusidestrconsts:lisprojectinformation msgid "Project Information" msgstr "Informace projektu" #: lazarusidestrconsts:lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" msgstr "" #: lazarusidestrconsts:lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" msgstr "" #: lazarusidestrconsts:lisuseincludefilter msgid "Use Include Filter" msgstr "Použít filtr zahrnutí" #: lazarusidestrconsts:lisincludefilter msgid "Include Filter" msgstr "Filtr zahrnutí" #: lazarusidestrconsts:dlgenvbckup msgid "Backup" msgstr "Záloha" #: lazarusidestrconsts:dlgnaming msgid "Naming" msgstr "Pojmenování" #: lazarusidestrconsts:lisfpdoceditor msgid "FPDoc editor" msgstr "Editor FPDoc" #: lazarusidestrconsts:lisokbtn msgid "Ok" msgstr "Ok" #: lazarusidestrconsts:dlgcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts:lissamselectnone msgid "Select none" msgstr "Vybraz žádný" #: lazarusidestrconsts:liskmclassic msgid "Classic" msgstr "Vzor" #: lazarusidestrconsts:liskmmacosx msgid "Mac OS X" msgstr "" #: lazarusidestrconsts:lispefilename msgid "Filename:" msgstr "Jméno souboru:" #: lazarusidestrconsts:lispeunitname msgid "Unitname:" msgstr "Jméno jednotky:" #: lazarusidestrconsts:lispvutheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts:lispetheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts:lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Neplatné jméno souboru jednotky" #: lazarusidestrconsts:lispvuapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lispeapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lispeinvalidunitname msgid "Invalid unitname" msgstr "" #: lazarusidestrconsts:lispvutheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts:lispetheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lispeconflictfound msgid "Conflict found" msgstr "Nalezen konflikt" #: lazarusidestrconsts:lispvuthereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts:lispethereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts:lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts:lisok msgid "&Ok" msgstr "&Ok" #: lazarusidestrconsts:liscmparameter msgid "Parameter" msgstr "Parametr" #: lazarusidestrconsts:lisctpleaseselectamacro msgid "please select a macro" msgstr "" #: lazarusidestrconsts:lisa2pcreatenewfile msgid "Create new file" msgstr "Vytvořit nový soubor" #: lazarusidestrconsts:dlgenvlanguage msgid "Language" msgstr "Jazyk" #: lazarusidestrconsts:dlgautosave msgid "Auto save" msgstr "Automaticky ukládat" #: lazarusidestrconsts:dlgedfiles msgid "Editor files" msgstr "Soubory editoru" #: lazarusidestrconsts:dlgenvproject msgid "Project" msgstr "Projekt" #: lazarusidestrconsts:podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "Přidat jednotku balíčku do sekce uses" #: lazarusidestrconsts:liscodebrowser msgid "Code browser" msgstr "Prohlížeš kódu" #: lazarusidestrconsts:dlgintvinsec msgid "Interval in secs" msgstr "Interval v sekundách" #: lazarusidestrconsts:dlgdesktopfiles msgid "Desktop files" msgstr "Soubory na ploše" #: lazarusidestrconsts:dlgsavedfile msgid "Save desktop settings to file" msgstr "Uložit nastavení plochy do souboru" #: lazarusidestrconsts:dlgloaddfile msgid "Load desktop settings from file" msgstr "Načíst nastavení plochy ze souboru" #: lazarusidestrconsts:dlgminimizeallonminimizemain msgid "Minimize all on minimize main" msgstr "Minimalizovat všechno při minimalizování hlavního" #: lazarusidestrconsts:dlghideideonrun msgid "Hide IDE windows on run" msgstr "Skrýt okna IDE při spuštění" #: lazarusidestrconsts:dlgpalhints msgid "Hints for component palette" msgstr "Popisky pro paletu komponent" #: lazarusidestrconsts:lischeckchangesondiskwithloading msgid "Check changes on disk with loading" msgstr "Zkontrolovat změny na disku s načtením" #: lazarusidestrconsts:dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "" #: lazarusidestrconsts:lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" msgstr "Dvojklikna zprávu skočí na umístění (jinak: jeden klik)" #: lazarusidestrconsts:dlgwinpos msgid "Window Positions" msgstr "Poloha okna" #: lazarusidestrconsts:dlgmainmenu msgid "Main Menu" msgstr "Hlavní menu" #: lazarusidestrconsts:dlgsrcedit msgid "Source Editor" msgstr "Editor zdrojového kódu" #: lazarusidestrconsts:dlgmsgs msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:dlgprojfiles msgid "Project files" msgstr "Soubory projektu" #: lazarusidestrconsts:dlgenvtype msgid "Type" msgstr "Typ" #: lazarusidestrconsts:dlgenvnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts:lisleft msgid "Left" msgstr "Levý" #: lazarusidestrconsts:dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Symbol ve předu (.~pp)" #: lazarusidestrconsts:lisnobackupfiles msgid "No backup files" msgstr "Nezálohovat soubory" #: lazarusidestrconsts:dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Symbol za (.~pp)" #: lazarusidestrconsts:dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Čítač (.pp;1)" #: lazarusidestrconsts:dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Uživatelsky definované rozšíření (.pp.xxx)" #: lazarusidestrconsts:dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "Stejné jméno (v podadresáři)" #: lazarusidestrconsts:dlgedcustomext msgid "User defined extension" msgstr "Uživatelsky definované rozšíření" #: lazarusidestrconsts:dlgmaxcntr msgid "Maximum counter" msgstr "Maximum čítače" #: lazarusidestrconsts:dlgedbsubdir msgid "Sub directory" msgstr "Podadresář" #: lazarusidestrconsts:dlgenvotherfiles msgid "Other files" msgstr "Jiné soubory" #: lazarusidestrconsts:dlgmaxrecentfiles msgid "Max recent files" msgstr "Maximum nedávných souborů" #: lazarusidestrconsts:dlgmaxrecentprojs msgid "Max recent project files" msgstr "Maximum nedávných souborů projektů" #: lazarusidestrconsts:dlgqopenlastprj msgid "Open last project at start" msgstr "Otevřít poslední projekt při startu" #: lazarusidestrconsts:dlgqshowcompiledialog msgid "Show compile dialog" msgstr "Zobrazit dialog překladače" #: lazarusidestrconsts:dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Adresář Lazarusu (výchozí pro všechny projekty)" #: lazarusidestrconsts:dlgfpcpath msgid "Compiler path (e.g. %s)" msgstr "Cesta překladače (např. %s)" #: lazarusidestrconsts:dlgfpcsrcpath msgid "FPC source directory" msgstr "Zdrojový adresář FPC" #: lazarusidestrconsts:dlgmakepath msgid "Make path" msgstr "Vytvořit cestu" #: lazarusidestrconsts:dlgdebugtype msgid "Debugger type and path" msgstr "" #: lazarusidestrconsts:dlgtestprjdir msgid "Directory for building test projects" msgstr "Složka pro sestavení pokusných projektů" #: lazarusidestrconsts:dlgqshowgrid msgid "Show grid" msgstr "Zobrazit mřížku" #: lazarusidestrconsts:dlgqshowborderspacing msgid "Show border spacing" msgstr "" #: lazarusidestrconsts:dlggridcolor msgid "Grid color" msgstr "Barva mřížky" #: lazarusidestrconsts:dlgqsnaptogrid msgid "Snap to grid" msgstr "Přichytit k mřížce" #: lazarusidestrconsts:dlggridx msgid "Grid size X" msgstr "Rozměr mřížky X" #: lazarusidestrconsts:dlggridxhint msgid "Horizontal grid step size" msgstr "Velikost horizontálního kroku mřížky" #: lazarusidestrconsts:dlggridy msgid "Grid size Y" msgstr "Rozměr mřížky Y" #: lazarusidestrconsts:dlggridyhint msgid "Vertical grid step size" msgstr "Velikost svislého kroku mřížky" #: lazarusidestrconsts:dlgguidelines msgid "Show Guide Lines" msgstr "Ukázat vodící čáry" #: lazarusidestrconsts:dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Přichycovat k vodícím čarám" #: lazarusidestrconsts:dlglefttopclr msgid "color for left, top" msgstr "" #: lazarusidestrconsts:dlgrightbottomclr msgid "color for right, bottom" msgstr "" #: lazarusidestrconsts:dlgshowcaps msgid "Show component captions" msgstr "" #: lazarusidestrconsts:dlgshowedrhints msgid "Show editor hints" msgstr "" #: lazarusidestrconsts:dlgautoform msgid "Auto create form when opening unit" msgstr "Automaticky vytvořit formulář při otevření jednotky" #: lazarusidestrconsts:dlgrightclickselects msgid "Right Click selects" msgstr "" #: lazarusidestrconsts:dlggrabbercolor msgid "Grabber color" msgstr "" #: lazarusidestrconsts:dlgmarkercolor msgid "Marker color" msgstr "Barva značkovače" #: lazarusidestrconsts:lisfepaintdesigneritemsonidle msgid "Reduce designer painting" msgstr "" #: lazarusidestrconsts:lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" msgstr "" #: lazarusidestrconsts:dlgenvgrid msgid "Grid" msgstr "Mřížka" #: lazarusidestrconsts:dlgenvlguidelines msgid "Guide lines" msgstr "Vodící čáry" #: lazarusidestrconsts:dlgenvmisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgruberbandselectioncolor msgid "Selection" msgstr "Výběr" #: lazarusidestrconsts:dlgruberbandcreationcolor msgid "Creation" msgstr "" #: lazarusidestrconsts:dlgrubberbandselectsgrandchilds msgid "Select grand childs" msgstr "" #: lazarusidestrconsts:dlgrubberbandgroup msgid "Rubber band" msgstr "" #: lazarusidestrconsts:dlgpasext msgid "Default pascal extension" msgstr "Výchozí přípona pascalu" #: lazarusidestrconsts:dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" msgstr "Uložit jako - automaticky přejmenovat pascalovské soubory na malé znaky" #: lazarusidestrconsts:dlgambigfileact msgid "Ambiguous file action:" msgstr "Nejednoznačná akce souboru:" #: lazarusidestrconsts:dlgenvask msgid "Ask" msgstr "Zeptat" #: lazarusidestrconsts:dlgautodel msgid "Auto delete file" msgstr "Automaticky smazat soubor" #: lazarusidestrconsts:dlgautoren msgid "Auto rename file lowercase" msgstr "Automaticky nastav malá písmena v názvu souboru" #: lazarusidestrconsts:dlgnoautomaticrenaming msgid "no automatic renaming" msgstr "automatické přejmenovávání ne" #: lazarusidestrconsts:dlgambigwarn msgid "Warn on compile" msgstr "Varování při překládání" #: lazarusidestrconsts:dlgignoreverb msgid "Ignore" msgstr "Ignorovat" #: lazarusidestrconsts:dlgbackcolor msgid "Background" msgstr "Pozadí" #: lazarusidestrconsts:dlgsubpropkcolor msgid "Subpropertes" msgstr "Podvlastnosti" #: lazarusidestrconsts:dlgreferencecolor msgid "Reference" msgstr "Odkazy" #: lazarusidestrconsts:dlgvaluecolor msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts:liswladd msgid "&Add" msgstr "&Přidat" #: lazarusidestrconsts:liswlproperties msgid "&Properties" msgstr "&Vlastnosti" #: lazarusidestrconsts:liswlenabled msgid "&Enabled" msgstr "&Povolený" #: lazarusidestrconsts:liswldelete msgid "&Delete" msgstr "&Smazat" #: lazarusidestrconsts:liswldisableall msgid "D&isable All" msgstr "Z&akázat vše" #: lazarusidestrconsts:liswlenableall msgid "E&nable All" msgstr "&Povolit vše" #: lazarusidestrconsts:liswldeleteall msgid "De&lete All" msgstr "Sma&zat vše" #: lazarusidestrconsts:dlgdefvaluecolor msgid "Default value" msgstr "Výchozí hodnota" #: lazarusidestrconsts:dlgpropnamecolor msgid "Property name" msgstr "Jméno vlastnosti" #: lazarusidestrconsts:dlgoimiscellaneous msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgoiitemheight msgid "Item height" msgstr "Výška položky" #: lazarusidestrconsts:lisshowhintsinobjectinspector msgid "Show hints in Object Inspector" msgstr "" #: lazarusidestrconsts:lisautoshowobjectinspector msgid "Auto show Object Inspector" msgstr "Automaticky zobrazit Inspektor objektů" #: lazarusidestrconsts:dlgenvcolors msgid "Colors" msgstr "Barvy" #: lazarusidestrconsts:dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Poznámky: Soubory projektu jsou všechny soubory v adresáři projektu" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "" #: lazarusidestrconsts:lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts:lisenvoptdlgdirectorynotfound msgid "Directory not found" msgstr "Složka nenalezena" #: lazarusidestrconsts:listhedirectorywasnotfound msgid "The directory %s was not found." msgstr "" #: lazarusidestrconsts:lisinstallationfailed msgid "Installation failed" msgstr "Instalace selhala" #: lazarusidestrconsts:lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgstr "" #: lazarusidestrconsts:lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "" #: lazarusidestrconsts:lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." msgstr "" #: lazarusidestrconsts:lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." msgstr "" #: lazarusidestrconsts:lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." msgstr "Testovací složka \"%s\" nenalezena." #: lazarusidestrconsts:dlgeddisplay msgid "Display" msgstr "Zobrazení" #: lazarusidestrconsts:liseotabwidths msgid "Tab widths" msgstr "" #: lazarusidestrconsts:dlgkeymapping msgid "Key Mappings" msgstr "Mapování kláves" #: lazarusidestrconsts:dlgedcolor msgid "Color" msgstr "Barva" #: lazarusidestrconsts:dlgkeymappingerrors msgid "Key mapping errors" msgstr "Chyba mapování kláves" #: lazarusidestrconsts:dlgedback msgid "Back" msgstr "Zpět" #: lazarusidestrconsts:dlgreport msgid "Report" msgstr "Hlášení" #: lazarusidestrconsts:dlgednoerr msgid "No errors in key mapping found." msgstr "" #: lazarusidestrconsts:dlgdeltemplate msgid "Delete template " msgstr "Odstranit šablonu" #: lazarusidestrconsts:dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Vyberte šablonu kódu (*.dci)" #: lazarusidestrconsts:dlgallfiles msgid "All files" msgstr "Všechny soubory" #: lazarusidestrconsts:lisold msgid "old" msgstr "starý" #: lazarusidestrconsts:lisnew msgid "new" msgstr "nový" #: lazarusidestrconsts:lisremove msgid "remove" msgstr "odstranit" #: lazarusidestrconsts:lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "Potvrdit novou sadu balíčků pro IDE" #: lazarusidestrconsts:listhiswillhappencontinue msgid "This will happen:%s%s%sContinue?" msgstr "Toto se stane:%s%s%sPokračovat?" #: lazarusidestrconsts:lissavefileas msgid "Save file as" msgstr "Uložit soubor jako" #: lazarusidestrconsts:lisopenexistingfile msgid "Open existing file" msgstr "Otevřít existující soubor" #: lazarusidestrconsts:lislazarusunit msgid "Lazarus unit" msgstr "Jednotka Lazarusu" #: lazarusidestrconsts:lislazarusinclude msgid "Lazarus include file" msgstr "Zahrnutý soubor Lazarusu" #: lazarusidestrconsts:lislazarusproject msgid "Lazarus project" msgstr "Projekt Lazarusu" #: lazarusidestrconsts:lislazarusform msgid "Lazarus form" msgstr "Formulář Lazarusu" #: lazarusidestrconsts:lislazaruspackage msgid "Lazarus package" msgstr "Balíček Lazarusu" #: lazarusidestrconsts:lislazarusprojectsource msgid "Lazarus project source" msgstr "Zdrojový soubor Lazarusu" #: lazarusidestrconsts:dlgaltsetclmode msgid "Alt-Key sets column mode" msgstr "Alk-klávesa nastavuje režim sloupce" #: lazarusidestrconsts:dlgalwaysvisiblecursor msgid "Always visible cursor" msgstr "Kurzor vždy viditelný" #: lazarusidestrconsts:dlgautoident msgid "Auto indent" msgstr "Automatické odsazení" #: lazarusidestrconsts:dlgbrachighlight msgid "Bracket highlighting" msgstr "Zvýraznění závorek" #: lazarusidestrconsts:dlgdragdroped msgid "Drag Drop editing" msgstr "Editace s uchop a táhni" #: lazarusidestrconsts:dlgdropfiles msgid "Drop files" msgstr "Umístit soubory" #: lazarusidestrconsts:dlggroupundo msgid "Group Undo" msgstr "" #: lazarusidestrconsts:dlghalfpagescroll msgid "Half page scroll" msgstr "" #: lazarusidestrconsts:dlgkeepcursorx msgid "Keep cursor X position" msgstr "" #: lazarusidestrconsts:dlgpersistentcursor msgid "Persistent cursor" msgstr "Trvalý ukazatel" #: lazarusidestrconsts:dlgcursorskipsselection msgid "Cursor skips selection" msgstr "" #: lazarusidestrconsts:dlgrightmousemovescursor msgid "Right mouse moves cursor" msgstr "" #: lazarusidestrconsts:dlgscrollbyoneless msgid "Scroll by one less" msgstr "" #: lazarusidestrconsts:dlgscrollpastendfile msgid "Scroll past end of file" msgstr "" #: lazarusidestrconsts:dlgscrollpastendline msgid "Scroll past end of line" msgstr "" #: lazarusidestrconsts:lisshowspecialcharacters msgid "Show special characters" msgstr "" #: lazarusidestrconsts:dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "" #: lazarusidestrconsts:dlgshowscrollhint msgid "Show scroll hint" msgstr "" #: lazarusidestrconsts:dlgmouselinks msgid "Mouse links" msgstr "" #: lazarusidestrconsts:dlgshowgutterhints msgid "Show gutter hints" msgstr "" #: lazarusidestrconsts:dlgsmarttabs msgid "Smart tabs" msgstr "" #: lazarusidestrconsts:dlgtabstospaces msgid "Tabs to spaces" msgstr "" #: lazarusidestrconsts:dlgtabindent msgid "Tab indents blocks" msgstr "" #: lazarusidestrconsts:dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "" #: lazarusidestrconsts:dlgundoaftersave msgid "Undo after save" msgstr "" #: lazarusidestrconsts:dlgdoubleclickline msgid "Double click line" msgstr "Dvojklik na řádek" #: lazarusidestrconsts:dlgfindtextatcursor msgid "Find text at cursor" msgstr "Najít text od kurzoru" #: lazarusidestrconsts:dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Použít zvýraznění syntaxe" #: lazarusidestrconsts:dlgusecodefolding msgid "Code folding" msgstr "" #: lazarusidestrconsts:dlgcopywordatcursoroncopynone msgid "Copy word on copy none" msgstr "" #: lazarusidestrconsts:dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "" #: lazarusidestrconsts:dlgblockindent msgid "Block indent" msgstr "Odsazení bloku" #: lazarusidestrconsts:dlgundolimit msgid "Undo limit" msgstr "" #: lazarusidestrconsts:dlgtabwidths msgid "Tab widths" msgstr "" #: lazarusidestrconsts:dlgmargingutter msgid "Margin and gutter" msgstr "" #: lazarusidestrconsts:dlgvisiblerightmargin msgid "Visible right margin" msgstr "Viditelný pravý okraj" #: lazarusidestrconsts:dlgvisiblegutter msgid "Visible gutter" msgstr "" #: lazarusidestrconsts:dlgshowlinenumbers msgid "Show line numbers" msgstr "" #: lazarusidestrconsts:dlgshowcompilinglinenumbers msgid "Show line numbers" msgstr "" #: lazarusidestrconsts:dlgrightmargin msgid "Right margin" msgstr "" #: lazarusidestrconsts:dlgrightmargincolor msgid "Right margin color" msgstr "" #: lazarusidestrconsts:dlggutterwidth msgid "Gutter width" msgstr "" #: lazarusidestrconsts:dlgguttercolor msgid "Gutter color" msgstr "" #: lazarusidestrconsts:dlgeditorfont msgid "Editor font" msgstr "Písmo editoru" #: lazarusidestrconsts:dlgdefaulteditorfont msgid "Default editor font" msgstr "Výchozí písmo editoru" #: lazarusidestrconsts:dlgeditorfontheight msgid "Editor font height" msgstr "Výška písma editoru" #: lazarusidestrconsts:dlgextracharspacing msgid "Extra char spacing" msgstr "" #: lazarusidestrconsts:dlgextralinespacing msgid "Extra line spacing" msgstr "" #: lazarusidestrconsts:dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "Schéma mapování kláves" #: lazarusidestrconsts:dlgcheckconsistency msgid "Check consistency" msgstr "Zkontrolovat konzistenci" #: lazarusidestrconsts:lisedoptschoosescheme msgid "Choose Scheme" msgstr "Vyberte schéma" #: lazarusidestrconsts:dlgedhintcommand msgid "Hint: click on the command you want to edit" msgstr "" #: lazarusidestrconsts:dlglang msgid "Language" msgstr "Jazyk" #: lazarusidestrconsts:dlgclrscheme msgid "Color Scheme" msgstr "Barevné schéma" #: lazarusidestrconsts:dlgfileexts msgid "File extensions" msgstr "Přípony souboru" #: lazarusidestrconsts:dlgedelement msgid "Element" msgstr "Prvek" #: lazarusidestrconsts:dlgsetelementdefault msgid "Set element to default" msgstr "Nastavit prvek na výchozí" #: lazarusidestrconsts:dlgsetallelementdefault msgid "Set all elements to default" msgstr "Nastavit všechny prvky na výchozí" #: lazarusidestrconsts:dlgforecolor msgid "Foreground color" msgstr "Barva popředí" #: lazarusidestrconsts:dlgedusedefcolor msgid "Use default color" msgstr "Použít výchozí barvu" #: lazarusidestrconsts:dlgtextattributes msgid "Text attributes" msgstr "Vlastnosti textu" #: lazarusidestrconsts:dlgedbold msgid "Bold" msgstr "Tučné" #: lazarusidestrconsts:dlgedital msgid "Italic" msgstr "Kurzíva" #: lazarusidestrconsts:dlgedunder msgid "Underline" msgstr "Podtržené" #: lazarusidestrconsts:dlgedon msgid "On" msgstr "Zapnuto" #: lazarusidestrconsts:dlgedoff msgid "Off" msgstr "Vypnuto" #: lazarusidestrconsts:dlgedinvert msgid "Invert" msgstr "Převrácené" #: lazarusidestrconsts:dlgedidcomlet msgid "Identifier completion" msgstr "Dokončení identifikátoru" #: lazarusidestrconsts:dlgedcodeparams msgid "Code parameters" msgstr "Parametry kódu" #: lazarusidestrconsts:dlgtooltipeval msgid "Tooltip expression evaluation" msgstr "" #: lazarusidestrconsts:dlgtooltiptools msgid "Tooltip symbol Tools" msgstr "" #: lazarusidestrconsts:dlgeddelay msgid "Delay" msgstr "Prodleva" #: lazarusidestrconsts:dlgtimesecondunit msgid "sec" msgstr "sekund" #: lazarusidestrconsts:dlgedcodetempl msgid "Code templates" msgstr "Šablony kódu" #: lazarusidestrconsts:dlgtplfname msgid "Template file name" msgstr "Jméno souboru šablony" #: lazarusidestrconsts:dlgedadd msgid "Add..." msgstr "Přidat..." #: lazarusidestrconsts:dlgededit msgid "Edit..." msgstr "Upravit..." #: lazarusidestrconsts:dlgeddelete msgid "Delete" msgstr "Odstranit" #: lazarusidestrconsts:dlgindentcodeto msgid "Indent code to" msgstr "Odsadit kód na" #: lazarusidestrconsts:dlgcodetoolstab msgid "Code Tools" msgstr "Nástroje kódu" #: lazarusidestrconsts:lisautomaticfeatures msgid "Automatic features" msgstr "Automatická vlastnost" #: lazarusidestrconsts:dlgcfdividerdrawlevel msgid "Divider Draw Level" msgstr "Úroveň kreslení rozdělovače" #: lazarusidestrconsts:dlgcodetoolsopts msgid "CodeTools Options" msgstr "" #: lazarusidestrconsts:dlgcodecreation msgid "Code Creation" msgstr "" #: lazarusidestrconsts:dlgwordspolicies msgid "Words" msgstr "Slova" #: lazarusidestrconsts:dlglinesplitting msgid "Line Splitting" msgstr "Dělení řádků" #: lazarusidestrconsts:dlgspacenotcosmos msgid "Space" msgstr "Mezera" #: lazarusidestrconsts:dlgidentifiercompletion msgid "Identifier completion" msgstr "Dokončení identifikátoru" #: lazarusidestrconsts:dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" msgstr "Doplňující zdrojové prohledávácí cesty pro všechny projekty(.pp;.pas)" #: lazarusidestrconsts:dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Skákání (např. metoda skákání)" #: lazarusidestrconsts:dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Přizpůsobit vrchní linku kvůli komentářú vpředu" #: lazarusidestrconsts:dlgcentercursorline msgid "Center Cursor Line" msgstr "Vystředit řádek ukazatele" #: lazarusidestrconsts:dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "" #: lazarusidestrconsts:dlgclassinsertpolicy msgid "Class part insert policy" msgstr "" #: lazarusidestrconsts:dlgalphabetically msgid "Alphabetically" msgstr "Abecedně" #: lazarusidestrconsts:dlgcdtlast msgid "Last" msgstr "Poslední" #: lazarusidestrconsts:dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "" #: lazarusidestrconsts:dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "" #: lazarusidestrconsts:dlglast msgid "Last (i.e. at end of source)" msgstr "" #: lazarusidestrconsts:dlginfrontofmethods msgid "In front of methods" msgstr "" #: lazarusidestrconsts:dlgbehindmethods msgid "Behind methods" msgstr "Za metodami" #: lazarusidestrconsts:dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Udržovat pořadí procedůr" #: lazarusidestrconsts:dlgmethodinspolicy msgid "Method insert policy" msgstr "Způsob vkládání metod" #: lazarusidestrconsts:dlgcdtclassorder msgid "Class order" msgstr "Pořadí tříd" #: lazarusidestrconsts:dlgkeywordpolicy msgid "Keyword policy" msgstr "" #: lazarusidestrconsts:dlgcdtlower msgid "lowercase" msgstr "" #: lazarusidestrconsts:dlgcdtuppercase msgid "UPPERCASE" msgstr "VELKÁ PÍSMENA" #: lazarusidestrconsts:dlg1up2low msgid "Lowercase, first letter up" msgstr "" #: lazarusidestrconsts:dlgidentifierpolicy msgid "Identifier policy" msgstr "" #: lazarusidestrconsts:dlgpropertycompletion msgid "Property completion" msgstr "Dokončení vlastnosti" #: lazarusidestrconsts:lisheadercommentforclass msgid "Header comment for class" msgstr "" #: lazarusidestrconsts:dlgcompleteproperties msgid "Complete properties" msgstr "Vlastnosti dokončení" #: lazarusidestrconsts:dlgcdtreadprefix msgid "Read prefix" msgstr "" #: lazarusidestrconsts:dlgcdtwriteprefix msgid "Write prefix" msgstr "Prefix zápisu" #: lazarusidestrconsts:dlgcdtstoredpostfix msgid "Stored postfix" msgstr "" #: lazarusidestrconsts:dlgcdtvariableprefix msgid "Variable prefix" msgstr "Prefix proměnné" #: lazarusidestrconsts:dlgsetpropertyvariable msgid "Set property Variable" msgstr "" #: lazarusidestrconsts:dlgmaxlinelength msgid "Max line length:" msgstr "" #: lazarusidestrconsts:dlgnotsplitlinefront msgid "Do not split line In front of:" msgstr "Nerozdělovat řádek před:" #: lazarusidestrconsts:dlgnotsplitlineafter msgid "Do not split line after:" msgstr "Nerozdělovat řádek po:" #: lazarusidestrconsts:dlgcdtpreview msgid "Preview (Max line length = 1)" msgstr "Náhled (max. délka řádku = 1)" #: lazarusidestrconsts:dlginsspacefront msgid "Insert space in front of" msgstr "" #: lazarusidestrconsts:dlginsspaceafter msgid "Insert space after" msgstr "" #: lazarusidestrconsts:dlgwrdpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts:dlgaddsemicolon msgid "Add semicolon" msgstr "Přidat středník" #: lazarusidestrconsts:dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "Přidat operátor přiřazení :=" #: lazarusidestrconsts:locwndsrceditor msgid "Source Editor" msgstr "" #: lazarusidestrconsts:dlgcompileroptions msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts:lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" msgstr "" #: lazarusidestrconsts:lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "" #: lazarusidestrconsts:dlgsearchpaths msgid "Paths" msgstr "Cesty" #: lazarusidestrconsts:dlgcoparsing msgid "Parsing" msgstr "" #: lazarusidestrconsts:dlgcodegeneration msgid "Code" msgstr "Kód" #: lazarusidestrconsts:dlgcolinking msgid "Linking" msgstr "" #: lazarusidestrconsts:dlgcomessages msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts:dlgcoother msgid "Other" msgstr "Jiné" #: lazarusidestrconsts:dlgcoinherited msgid "Inherited" msgstr "Sděděný" #: lazarusidestrconsts:dlgcocompilation msgid "Compilation" msgstr "Sestavení" #: lazarusidestrconsts:lisbrowseforcompiler msgid "Browse for Compiler (%s)" msgstr "Procházet pro překladač" #: lazarusidestrconsts:lisunitoutputdirectory msgid "Unit Output directory" msgstr "Výstupní adresář jednotky" #: lazarusidestrconsts:lisselectanode msgid "Select a node" msgstr "Vyberat uzel" #: lazarusidestrconsts:dlgshowcompileroptions msgid "Show compiler options" msgstr "Zobrazit nastavení překladače" #: lazarusidestrconsts:dlgcoopts msgid "Options: " msgstr "Nastavení:" #: lazarusidestrconsts:dlgcoasmstyle msgid "Assembler style:" msgstr "Styl assembleru:" #: lazarusidestrconsts:lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "Nezděděny žádné volby překladače " #: lazarusidestrconsts:lisunitpath msgid "unit path" msgstr "cesta jednotky" #: lazarusidestrconsts:lisincludepath msgid "include path" msgstr "" #: lazarusidestrconsts:lisobjectpath msgid "object path" msgstr "cesta objektu" #: lazarusidestrconsts:lislibrarypath msgid "library path" msgstr "cesta knihovny" #: lazarusidestrconsts:lislinkeroptions msgid "linker options" msgstr "" #: lazarusidestrconsts:liscustomoptions msgid "custom options" msgstr "vlastní nastavení" #: lazarusidestrconsts:dlgcoasis msgid "As-Is" msgstr "As-Is" #: lazarusidestrconsts:dlgsyntaxoptions msgid "Syntax options" msgstr "Nastavení syntaxe" #: lazarusidestrconsts:dlgassemblerdefault msgid "Default" msgstr "Výchozí" #: lazarusidestrconsts:dlgdelphi2ext msgid "Delphi 2 Extensions" msgstr "Rozšíření Delphi 2" #: lazarusidestrconsts:dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" msgstr "Operátory ve stylu C (*=, +=, /= and -=)" #: lazarusidestrconsts:dlgassertcode msgid "Include Assertion Code" msgstr "" #: lazarusidestrconsts:dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Povolit LABEL a GOTO" #: lazarusidestrconsts:dlgcppinline msgid "C++ Styled INLINE" msgstr "INLINE ve stylu C++" #: lazarusidestrconsts:dlgcmacro msgid "C Style Macros (global)" msgstr "Makra ve stylu C (globální)" #: lazarusidestrconsts:dlgbp7cptb msgid "TP/BP 7.0 Compatible" msgstr "" #: lazarusidestrconsts:dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Jméno konstruktoru musí být 'init' (destruktor musí být 'done')" #: lazarusidestrconsts:dlgstatickeyword msgid "Static Keyword in Objects" msgstr "" #: lazarusidestrconsts:dlgdeplhicomp msgid "Delphi Compatible" msgstr "Kompatibilní s Delphi" #: lazarusidestrconsts:dlgcoansistr msgid "Use Ansi Strings" msgstr "Použít Ansi řetězce" #: lazarusidestrconsts:dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" msgstr "Kompatibilní s GPC (GNU Pascal Compiler)" #: lazarusidestrconsts:dlgcounitstyle msgid "Unit Style:" msgstr "Styl jednotky:" #: lazarusidestrconsts:dlgcosmartlinkable msgid "Smart Linkable" msgstr "" #: lazarusidestrconsts:dlgcochecks msgid "Checks:" msgstr "Kontroly:" #: lazarusidestrconsts:dlgcorange msgid "Range" msgstr "Rozsah" #: lazarusidestrconsts:dlgcooverflow msgid "Overflow" msgstr "Přetečení" #: lazarusidestrconsts:dlgcostack msgid "Stack" msgstr "Zásobník" #: lazarusidestrconsts:dlgheapsize msgid "Heap Size" msgstr "Velikost haldy" #: lazarusidestrconsts:dlgcogenerate msgid "Generate:" msgstr "Generovat:" #: lazarusidestrconsts:dlgconormal msgid "Normal Code" msgstr "" #: lazarusidestrconsts:dlgcofast msgid "Faster Code" msgstr "Rychlejší kód" #: lazarusidestrconsts:dlgcosmaller msgid "Smaller Code" msgstr "" #: lazarusidestrconsts:dlgtargetproc msgid "Target processor" msgstr "Cílový procesor" #: lazarusidestrconsts:dlgtargetplatform msgid "Target Platform:" msgstr "Cílová platforma:" #: lazarusidestrconsts:dlgoptimiz msgid "Optimizations:" msgstr "Optimalizace:" #: lazarusidestrconsts:dlgcokeepvarsreg msgid "Keep certain variables in registers" msgstr "Udržovat některé proměnné v registrech" #: lazarusidestrconsts:dlguncertopt msgid "Uncertain Optimizations" msgstr "Neurčitá optimalizace" #: lazarusidestrconsts:dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" msgstr "Úroveň 0 (bez zvláštní optimalizace)" #: lazarusidestrconsts:dlglevel1opt msgid "Level 1 (quick and debugger friendly)" msgstr "Úroveň 1 (rychlé a přáteské k ladění)" #: lazarusidestrconsts:dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" msgstr "Úroveň 2 (Úroveň 1 + rychlá optimalizace)" #: lazarusidestrconsts:dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" msgstr "Úroveň 3 (Úroveň 2 + pomalá optimalizace)" #: lazarusidestrconsts:dlgtargetos msgid "Target OS" msgstr "Cílový OS" #: lazarusidestrconsts:dlgtargetcpu msgid "Target CPU" msgstr "Cílové CPU" #: lazarusidestrconsts:dlgcodebugging msgid "Debugging:" msgstr "Ladění:" #: lazarusidestrconsts:dlgcogdb msgid "Generate Debugging Info For GDB (Slows Compiling)" msgstr "" #: lazarusidestrconsts:dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" msgstr "" #: lazarusidestrconsts:dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování" #: lazarusidestrconsts:dlgcoheaptrc msgid "Use Heaptrc Unit" msgstr "Použít jednotku Heaptrc" #: lazarusidestrconsts:dlgcovalgrind msgid "Generate code for valgrind" msgstr "" #: lazarusidestrconsts:dlggprof msgid "Generate code for gprof" msgstr "" #: lazarusidestrconsts:dlgcostrip msgid "Strip Symbols From Executable" msgstr "" #: lazarusidestrconsts:dlglinklibraries msgid "Link Style:" msgstr "" #: lazarusidestrconsts:dlglinksmart msgid "Link Smart" msgstr "" #: lazarusidestrconsts:dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" msgstr "" #: lazarusidestrconsts:liscotargetosspecificoptions msgid "Target OS specific options" msgstr "Speciální nastavení pro cílový OS" #: lazarusidestrconsts:dlgwin32guiapp msgid "Win32 gui application" msgstr "Win32 GUI aplikace" #: lazarusidestrconsts:dlgverbosity msgid "Verbosity during compilation:" msgstr "Užvaněnost během překládání:" #: lazarusidestrconsts:dlgcoshowerr msgid "Show Errors" msgstr "Ukázat chyby" #: lazarusidestrconsts:dlgshowwarnings msgid "Show Warnings" msgstr "Ukázat varování" #: lazarusidestrconsts:dlgshownotes msgid "Show Notes" msgstr "Ukázat poznámky" #: lazarusidestrconsts:dlgshowhint msgid "Show Hints" msgstr "Ukázat pokyny" #: lazarusidestrconsts:dlgshowgeneralinfo msgid "Show general info" msgstr "Ukázat obecné informace" #: lazarusidestrconsts:dlgshowprocserror msgid "Show all procs on error" msgstr "" #: lazarusidestrconsts:dlgshoweverything msgid "Show everything" msgstr "Ukázat vše" #: lazarusidestrconsts:dlgshowsummary msgid "Show summary" msgstr "Ukázat přehled" #: lazarusidestrconsts:dlgshowdebuginfo msgid "Show debug info" msgstr "Ukázat ladící informace" #: lazarusidestrconsts:dlgshowusedfiles msgid "Show used files" msgstr "Ukázat použité soubory" #: lazarusidestrconsts:dlgshowtriedfiles msgid "Show tried files" msgstr "" #: lazarusidestrconsts:dlgshowdefinedmacros msgid "Show defined macros" msgstr "Ukázat definované makra" #: lazarusidestrconsts:dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "Ukázat kompilované procedury" #: lazarusidestrconsts:dlgshowconditionals msgid "Show conditionals" msgstr "Ukázat podmínky" #: lazarusidestrconsts:dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "Ukázat spustitelné informace (pouze Win32)" #: lazarusidestrconsts:dlgshownothing msgid "Show nothing (only errors)" msgstr "Neukázat nic (pouze chyby)" #: lazarusidestrconsts:dlgwritefpclogo msgid "Write an FPC logo" msgstr "Zapsat FPC logo" #: lazarusidestrconsts:dlghintsunused msgid "Show Hints for unused units in main source" msgstr "" #: lazarusidestrconsts:dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" msgstr "" #: lazarusidestrconsts:dlgconfigfiles msgid "Config Files:" msgstr "Konfigurační soubory:" #: lazarusidestrconsts:dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)" #: lazarusidestrconsts:dlgusecustomconfig msgid "Use addional Compiler Config File" msgstr "Použít doplňkový konfigurační soubor překladače" #: lazarusidestrconsts:liscustomoptions2 msgid "Custom options" msgstr "Vlastní nastavení" #: lazarusidestrconsts:dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Zastavit po počtu chyb:" #: lazarusidestrconsts:dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "" #: lazarusidestrconsts:dlgcoincfiles msgid "Include Files (-Fi):" msgstr "" #: lazarusidestrconsts:dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "" #: lazarusidestrconsts:dlgcolibraries msgid "Libraries (-Fl):" msgstr "Knihovny (-Fl):" #: lazarusidestrconsts:dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Přidavná cesta ladícího nástroje (žádná):" #: lazarusidestrconsts:liscompiler msgid "Compiler" msgstr "Překladač" #: lazarusidestrconsts:listofpcpath msgid "Path:" msgstr "Cesta:" #: lazarusidestrconsts:liscoskipcallingcompiler msgid "Skip calling Compiler" msgstr "Přeskočit volání překladače" #: lazarusidestrconsts:liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "Nejednoznačný přídavný konfigurační soubor překladače" #: lazarusidestrconsts:liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá FreePascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace." #: lazarusidestrconsts:liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat." #: lazarusidestrconsts:liscocallon msgid "Call on:" msgstr "Volat při:" #: lazarusidestrconsts:liscocalloncompile msgid "Compile" msgstr "Přeložit" #: lazarusidestrconsts:liscocallonbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:liscocallonrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts:dlgcocreatemakefile msgid "Create Makefile" msgstr "Vytvořit Makefile" #: lazarusidestrconsts:liscoexecuteafter msgid "Execute after" msgstr "Spustit pak" #: lazarusidestrconsts:liscoexecutebefore msgid "Execute before" msgstr "Spustit před" #: lazarusidestrconsts:lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Přídavné volby překladače zděděné z balíčků." #: lazarusidestrconsts:liscocommand msgid "Command:" msgstr "Příkaz:" #: lazarusidestrconsts:liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "" #: lazarusidestrconsts:liscoscanformakemessages msgid "Scan for Make messages" msgstr "" #: lazarusidestrconsts:liscoshowallmessages msgid "Show all messages" msgstr "Ukázat všechna hlášení" #: lazarusidestrconsts:dlgunitoutp msgid "Unit output directory (-FU):" msgstr "Výstupní adresář jednotky (-FU):" #: lazarusidestrconsts:liscodefault msgid "default (%s)" msgstr "výchozí (%s)" #: lazarusidestrconsts:dlgbutapply msgid "Apply" msgstr "Použít" #: lazarusidestrconsts:dlgcoshowoptions msgid "Show Options" msgstr "Ukázat nastavení" #: lazarusidestrconsts:dlgcoloadsave msgid "Load/Save" msgstr "Načíst/Uložit" #: lazarusidestrconsts:dlgmainviewforms msgid "View project forms" msgstr "Zobrazit formuláře projektu" #: lazarusidestrconsts:dlgmainviewunits msgid "View project units" msgstr "Zobrazit jednotky projektu" #: lazarusidestrconsts:dlgmainviewframes msgid "View project frames" msgstr "Zobrazit rámce projektů" #: lazarusidestrconsts:dlgmultiselect msgid "Multi Select" msgstr "Vícenásobný výběr" #: lazarusidestrconsts:dlgccocaption msgid "Checking compiler options" msgstr "Kontrolování voleb překladače" #: lazarusidestrconsts:dlgccotest msgid "Test" msgstr "Test" #: lazarusidestrconsts:dlgccoresults msgid "Results" msgstr "Výsledky" #: lazarusidestrconsts:lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "Zkopírovat výstup do schránky" #: lazarusidestrconsts:lisccocontains msgid "contains " msgstr "obsahuje" #: lazarusidestrconsts:lisccospaces msgid "spaces" msgstr "mezery" #: lazarusidestrconsts:lisccospecialcharacters msgid "special characters" msgstr "speciální znaky" #: lazarusidestrconsts:lisccononascii msgid "non ASCII" msgstr "ne ASCII" #: lazarusidestrconsts:lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "špatný oddělovač cest" #: lazarusidestrconsts:lisccounusualchars msgid "unusual characters" msgstr "neobvyklé znaky" #: lazarusidestrconsts:lisccohasnewline msgid "new line symbols" msgstr "nové řádkové symboly" #: lazarusidestrconsts:lisccoinvalidsearchpath msgid "Invalid search path" msgstr "Neplatná hledací cesta" #: lazarusidestrconsts:lisccoskip msgid "Skip" msgstr "Přeskočit" #: lazarusidestrconsts:dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "Test: Kontrola překladače..." #: lazarusidestrconsts:lisdoesnotexists msgid "%s does not exists: %s" msgstr "%s neexistuje: %s" #: lazarusidestrconsts:lisccoinvalidcompiler msgid "Invalid compiler" msgstr "Neplatný překladač" #: lazarusidestrconsts:lisccocompilernotanexe msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "" #: lazarusidestrconsts:lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "Nejednoznačný překladač" #: lazarusidestrconsts:lisccoseveralcompilers msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "" #: lazarusidestrconsts:dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." msgstr "Test: Kontrola nastavení fpc..." #: lazarusidestrconsts:liscconocfgfound msgid "no fpc.cfg found" msgstr "" #: lazarusidestrconsts:lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "" #: lazarusidestrconsts:dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "Test: Překládání prázdného souboru..." #: lazarusidestrconsts:lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "" #: lazarusidestrconsts:lisccochecktestdir msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects" msgstr "" #: lazarusidestrconsts:lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "" #: lazarusidestrconsts:lisccounabletocreatetestpascalfile msgid "Unable to create Test pascal file \"%s\"." msgstr "" #: lazarusidestrconsts:dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "Test: Překládání prázdného souboru." #: lazarusidestrconsts:lisccorelunitpathfoundincfg msgid "relative unit path found in fpc cfg: %s" msgstr "" #: lazarusidestrconsts:dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "Test: Kontrola nastavení překladače..." #: lazarusidestrconsts:lisccoenglishmessagefilemissing msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg" msgstr "chybí soubor anglických hlášení pro fpc:components/codetools/fpc.errore.msg" #: lazarusidestrconsts:lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" msgstr "" #: lazarusidestrconsts:lisccomissingunit msgid "Missing unit" msgstr "Chybějcí jednotka" #: lazarusidestrconsts:lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." msgstr "" #: lazarusidestrconsts:dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." msgstr "Test: Kontrola chybějících fpc ppu..." #: lazarusidestrconsts:dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "Test: Kontrola datumu překladače..." #: lazarusidestrconsts:lisccoerrorcaption msgid "Error" msgstr "Chyba" #: lazarusidestrconsts:lisemdemtpymethods msgid "Emtpy Methods" msgstr "Prázdné metody" #: lazarusidestrconsts:lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "" #: lazarusidestrconsts:lisunabletoloadpackage msgid "Unable to load package %s%s%s" msgstr "Nelze přečíst balíček %s%s%" #: lazarusidestrconsts:lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "" #: lazarusidestrconsts:lissamisanabstractclassithasabstractmethods msgid "%s is an abstract class, it has %s abstract methods." msgstr "%s je abstraktní třída, protože má abstraktní metody %s." #: lazarusidestrconsts:lissamabstractmethodsof msgid "Abstract methods of %s" msgstr "Abstraktní metody %s" #: lazarusidestrconsts:lissamthereareabstractmethodstooverrideselectthemethodsf msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "" #: lazarusidestrconsts:lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "Nenalezeny abstraktní metody" #: lazarusidestrconsts:lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "" #: lazarusidestrconsts:lissamideisbusy msgid "IDE is busy" msgstr "IDE je zaneprázdněno" #: lazarusidestrconsts:lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "" #: lazarusidestrconsts:lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "" #: lazarusidestrconsts:lisccounabletogetfiledate msgid "Unable to get file date of %s." msgstr "Nelze získat datum souboru %s." #: lazarusidestrconsts:lisccowarningcaption msgid "Warning" msgstr "Varování" #: lazarusidestrconsts:lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "" #: lazarusidestrconsts:lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "" #: lazarusidestrconsts:lisccoppuexiststwice msgid "ppu exists twice: %s, %s" msgstr "" #: lazarusidestrconsts:dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..." #: lazarusidestrconsts:lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "" #: lazarusidestrconsts:listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." msgstr "" #: lazarusidestrconsts:listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr "Výstupní adresář by měl být samostatný adresář a neměl by obsahovat žádné zdrojové soubory." #: lazarusidestrconsts:listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." msgstr "" #: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "" #: lazarusidestrconsts:listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "" #: lazarusidestrconsts:lisccotestssuccess msgid "All tests succeeded." msgstr "Všechny testy se zdařily." #: lazarusidestrconsts:lisccowarningmsg msgid "WARNING: " msgstr "VAROVÁNÍ: " #: lazarusidestrconsts:lisccohintmsg msgid "HINT: " msgstr "POKYN:" #: lazarusidestrconsts:lisccoerrormsg msgid "ERROR: " msgstr "CHYBA:" #: lazarusidestrconsts:dlgcommandlineparameters msgid "Command line parameters" msgstr "Parametry příkazové řádky" #: lazarusidestrconsts:dlgprojectoptions msgid "Project Options" msgstr "Volby projektu" #: lazarusidestrconsts:dlgpoapplication msgid "Application" msgstr "Aplikace" #: lazarusidestrconsts:lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." msgstr "Aplikace%sGrafický program LCL/FreePascal. Soubor programu je automaticky spravován Lazarusem." #: lazarusidestrconsts:dlgpofroms msgid "Forms" msgstr "Formuláře" #: lazarusidestrconsts:dlgpomisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts:dlgpoi18n msgid "i18n" msgstr "" #: lazarusidestrconsts:rsenablei18n msgid "Enable i18n" msgstr "Povolit i18n" #: lazarusidestrconsts:rsi18noptions msgid "i18n Options" msgstr "Nastavení i18n" #: lazarusidestrconsts:rspooutputdirectory msgid "PO Output Directory:" msgstr "Výstupní adresář pro PO:" #: lazarusidestrconsts:rsincludeversioninfoinexecutable msgid "Include Version Info in executable" msgstr "" #: lazarusidestrconsts:rsversionnumbering msgid "Version numbering" msgstr "Číslování verze" #: lazarusidestrconsts:rsversion msgid "Version:" msgstr "Verze:" #: lazarusidestrconsts:rsmajorrevision msgid "Major revision:" msgstr "Hlavní verze:" #: lazarusidestrconsts:rsminorrevision msgid "Minor revision:" msgstr "Minoritní verze:" #: lazarusidestrconsts:rsbuild msgid "Build:" msgstr "Sestavení:" #: lazarusidestrconsts:rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "Automaticky zvyšovat číslo sestavení" #: lazarusidestrconsts:rslanguageoptions msgid "Language options" msgstr "Nastavení jazyku" #: lazarusidestrconsts:rslanguageselection msgid "Language selection:" msgstr "Výběr jazyku:" #: lazarusidestrconsts:rscharacterset msgid "Character set:" msgstr "Mapa znaků:" #: lazarusidestrconsts:rsotherinfo msgid "Other info" msgstr "Jiné informace" #: lazarusidestrconsts:rscopyright msgid "Copyright:" msgstr "Kopírovací práva:" #: lazarusidestrconsts:rsadditionalinfo msgid "Additional info" msgstr "Doplňující informace" #: lazarusidestrconsts:dlgposavesession msgid "Session" msgstr "Sezení" #: lazarusidestrconsts:dlgapplicationsettings msgid "Application Settings" msgstr "Nastavení aplikace" #: lazarusidestrconsts:dlgpotitle msgid "Title:" msgstr "Nadpis:" #: lazarusidestrconsts:dlgpooutputsettings msgid "Output Settings" msgstr "Nastavení výstupu" #: lazarusidestrconsts:dlgpotargetfilename msgid "Target file name:" msgstr "Cílové jméno souboru:" #: lazarusidestrconsts:dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" msgstr "Použít aplikační balík pro spuštění a ladění (pouze darwin)" #: lazarusidestrconsts:dlgpocreateappbundle msgid "Create Application Bundle" msgstr "Vytvořit aplikační balík" #: lazarusidestrconsts:dlgpousemanifest msgid "Use manifest file to enable themes (windows only)" msgstr "Použít soubor manifest k povolení grafických stylů (pouze Windows)" #: lazarusidestrconsts:dlgautocreateforms msgid "Auto-create forms:" msgstr "Automaticky vytvořené formuláře:" #: lazarusidestrconsts:dlgavailableforms msgid "Available forms:" msgstr "Dostupné formuláře:" #: lazarusidestrconsts:dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" msgstr "Při vytváření nových forem je přidej do automaticky vytvářených forem." #: lazarusidestrconsts:dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "" #: lazarusidestrconsts:dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "" #: lazarusidestrconsts:lismainunitispascalsource msgid "Main Unit is Pascal Source" msgstr "" #: lazarusidestrconsts:lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" msgstr "" #: lazarusidestrconsts:lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" msgstr "" #: lazarusidestrconsts:lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" msgstr "" #: lazarusidestrconsts:lisprojectisrunnable msgid "Project is runnable" msgstr "" #: lazarusidestrconsts:lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Vždy sestavit (i pokud se nic nezmění)" #: lazarusidestrconsts:dlgrunparameters msgid "Run parameters" msgstr "Spustit s parametry" #: lazarusidestrconsts:dlgrunolocal msgid "Local" msgstr "Místní" #: lazarusidestrconsts:dlgrunoenvironment msgid "Environment" msgstr "Prostředí" #: lazarusidestrconsts:dlghostapplication msgid "Host application" msgstr "" #: lazarusidestrconsts:dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "" #: lazarusidestrconsts:dlguselaunchingapp msgid "Use launching application" msgstr "Použít spouštěcí aplikaci" #: lazarusidestrconsts:lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "Spouštím aplikaci" #: lazarusidestrconsts:dlgroworkingdirectory msgid "Working directory" msgstr "Pracovní složka:" #: lazarusidestrconsts:dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts:dlgrunousedisplay msgid "Use display" msgstr "Použít zobrazení" #: lazarusidestrconsts:dlgrunosystemvariables msgid "System variables" msgstr "Systémové proměnné" #: lazarusidestrconsts:dlgrunovariable msgid "Variable" msgstr "Proměnná" #: lazarusidestrconsts:dlgrunovalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts:dlgrunouseroverrides msgid "User overrides" msgstr "Uživatelské předefinování" #: lazarusidestrconsts:dlgincludesystemvariables msgid "Include system variables" msgstr "" #: lazarusidestrconsts:dlgdirectorydoesnotexist msgid "Directory does not exist" msgstr "Složka neexistuje" #: lazarusidestrconsts:lisrunparamsfilenotexecutable msgid "File not executable" msgstr "Soubor není spustitelný" #: lazarusidestrconsts:lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "" #: lazarusidestrconsts:dlgthedirectory msgid "The directory \"" msgstr "Adresář \"" #: lazarusidestrconsts:dlgdoesnotexist msgid "\" does not exist." msgstr "\" neexistuje." #: lazarusidestrconsts:dlgtexttofing msgid "&Text to Find" msgstr "&Text k nalezení" #: lazarusidestrconsts:dlgreplacewith msgid "&Replace With" msgstr "&Nahradit s" #: lazarusidestrconsts:dlgfropts msgid "Options" msgstr "Nastavení" #: lazarusidestrconsts:lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor ..." msgstr "Když tento soubor je aktivní v editoru ..." #: lazarusidestrconsts:lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts:lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts:liscefilter msgid "(Filter)" msgstr "(Filtr)" #: lazarusidestrconsts:dlgcasesensitive msgid "&Case Sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts:lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Rozlišovat velká a malá písmena např. A a a" #: lazarusidestrconsts:dlgwholewordsonly msgid "&Whole Words Only" msgstr "&Pouze celková slova" #: lazarusidestrconsts:lisonlysearchforwholewords msgid "Only search for whole words" msgstr "" #: lazarusidestrconsts:dlgregularexpressions msgid "&Regular Expressions" msgstr "&Regulární výrazy" #: lazarusidestrconsts:lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)" #: lazarusidestrconsts:lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Povolit vyhledávání více řádků" #: lazarusidestrconsts:dlgpromptonreplace msgid "&Prompt On Replace" msgstr "&Dotázat se při nahrazení" #: lazarusidestrconsts:lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Zeptat před nahrazením každého nalezeného textu" #: lazarusidestrconsts:dlgsrorigin msgid "Origin" msgstr "Původ" #: lazarusidestrconsts:dlgpldpackagegroup msgid "Package group" msgstr "Skupina balíčků" #: lazarusidestrconsts:lispldexists msgid "Exists" msgstr "Existuje" #: lazarusidestrconsts:dlgfromcursor msgid "&From Cursor" msgstr "&Od kurzoru" #: lazarusidestrconsts:dlgentirescope msgid "&Entire Scope" msgstr "&Celkový rozsah" #: lazarusidestrconsts:dlgscope msgid "Scope" msgstr "Rozsah" #: lazarusidestrconsts:liswithrequiredpackages msgid "With required packages" msgstr "S požadovanými balíčky" #: lazarusidestrconsts:lislevels msgid "Levels" msgstr "Úrovně" #: lazarusidestrconsts:lisshowpackages msgid "Show packages" msgstr "Ukázat balíčky" #: lazarusidestrconsts:lisshowunits msgid "Show units" msgstr "Ukázat jednotky" #: lazarusidestrconsts:lisshowidentifiers msgid "Show identifiers" msgstr "Ukázat identifikátory" #: lazarusidestrconsts:lisfilter msgid "Filter" msgstr "Filtr" #: lazarusidestrconsts:lisregularexpression msgid "Regular expression" msgstr "Regulární výrazy" #: lazarusidestrconsts:lisinvalidfilter msgid "Invalid filter" msgstr "Neplatnýá filtr" #: lazarusidestrconsts:lisinvalidexpression msgid "Invalid expression:%s%s%s%s" msgstr "Neplatný výraz:%s%s%s%s" #: lazarusidestrconsts:lisexcludefilter2 msgid "Exclude filter" msgstr "Filtr vyřazení" #: lazarusidestrconsts:lisprivate msgid "Private" msgstr "Soukromý" #: lazarusidestrconsts:lisprotected msgid "Protected" msgstr "Chráněné" #: lazarusidestrconsts:lisemdpublic msgid "Public" msgstr "Veřejný" #: lazarusidestrconsts:lisemdpublished msgid "Published" msgstr "Zveřejněné" #: lazarusidestrconsts:lisemdall msgid "All" msgstr "Všechno" #: lazarusidestrconsts:lisemdonlypublished msgid "Only published" msgstr "Pouze zveřejněné" #: lazarusidestrconsts:lisemdfoundemptymethods msgid "Found empty methods:" msgstr "" #: lazarusidestrconsts:lisemdremovemethods msgid "Remove methods" msgstr "Odstranit metody" #: lazarusidestrconsts:lisexpandallpackages msgid "Expand all packages" msgstr "" #: lazarusidestrconsts:liscollapseallpackages msgid "Collapse all packages" msgstr "" #: lazarusidestrconsts:lisexpandallunits msgid "Expand all units" msgstr "" #: lazarusidestrconsts:liscollapseallunits msgid "Collapse all units" msgstr "" #: lazarusidestrconsts:lisexpandallclasses msgid "Expand all classes" msgstr "" #: lazarusidestrconsts:liscollapseallclasses msgid "Collapse all classes" msgstr "" #: lazarusidestrconsts:lisexport msgid "Export ..." msgstr "Exportovat..." #: lazarusidestrconsts:lisbegins msgid "begins" msgstr "začátky" #: lazarusidestrconsts:lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "Identifikátor začíná s..." #: lazarusidestrconsts:lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "Jméno jednotky začíná s..." #: lazarusidestrconsts:lispackagenamebeginswith msgid "Package name begins with ..." msgstr "Jméno balíčku začíná s..." #: lazarusidestrconsts:liscontains msgid "contains" msgstr "obsahuje" #: lazarusidestrconsts:lisidentifiercontains msgid "Identifier contains ..." msgstr "Identifikátor obsahuje..." #: lazarusidestrconsts:lisunitnamecontains msgid "Unit name contains ..." msgstr "Jméno jednotky obsahuje..." #: lazarusidestrconsts:lispackagenamecontains msgid "Package name contains ..." msgstr "Jméno balíčku obsahuje..." #: lazarusidestrconsts:lisfriincurrentunit msgid "in current unit" msgstr "v aktuální jednotce" #: lazarusidestrconsts:lisfriinmainproject msgid "in main project" msgstr "v hlavním projektu" #: lazarusidestrconsts:lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "" #: lazarusidestrconsts:lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "" #: lazarusidestrconsts:lisfrirenameallreferences msgid "Rename all References" msgstr "Přejmenovat všechny výskyty" #: lazarusidestrconsts:dlgglobal msgid "&Global" msgstr "&Celkový" #: lazarusidestrconsts:lisplduser msgid "User" msgstr "Uživatel" #: lazarusidestrconsts:dlgselectedtext msgid "&Selected Text" msgstr "&Vybraný text" #: lazarusidestrconsts:dlgdirection msgid "Direction" msgstr "Směr" #: lazarusidestrconsts:lisfrforwardsearch msgid "Forwar&d search" msgstr "Hleda&t dopředu" #: lazarusidestrconsts:lisfrbackwardsearch msgid "&Backward search" msgstr "&Hledat pozpátku" #: lazarusidestrconsts:dlgupword msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts:lisright msgid "Right" msgstr "Vpravo" #: lazarusidestrconsts:dlgdownword msgid "Down" msgstr "Dolů" #: lazarusidestrconsts:dlgreplaceall msgid "Replace &All" msgstr "Nahradit &vše" #: lazarusidestrconsts:dlggetposition msgid "Get position" msgstr "Získat pozici" #: lazarusidestrconsts:dlgleftpos msgid "Left:" msgstr "Vlevo:" #: lazarusidestrconsts:dlgwidthpos msgid "Width:" msgstr "Šířka:" #: lazarusidestrconsts:dlgtoppos msgid "Top:" msgstr "Nahoře:" #: lazarusidestrconsts:dlgheightpos msgid "Height:" msgstr "Výška:" #: lazarusidestrconsts:rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Uživatelské nastavení manažeru oken" #: lazarusidestrconsts:rsiwpdefault msgid "Default" msgstr "Výchozí" #: lazarusidestrconsts:rsiwprestorewindowgeometry msgid "Restore window geometry" msgstr "Obnovit rozměry okna" #: lazarusidestrconsts:rsiwpdocked msgid "Docked" msgstr "Ukotvený" #: lazarusidestrconsts:rsiwpcustomposition msgid "Custom position" msgstr "Vlastní pozice" #: lazarusidestrconsts:rsiwprestorewindowsize msgid "Restore window size" msgstr "Obnovit velikost okna" #: lazarusidestrconsts:liscodeexplorer msgid "Code Explorer" msgstr "Prohlížeč kódu" #: lazarusidestrconsts:uemfinddeclaration msgid "&Find Declaration" msgstr "&Najít deklaraci" #: lazarusidestrconsts:uemopenfileatcursor msgid "&Open file at cursor" msgstr "&Otevřít soubor na pozici kurzoru" #: lazarusidestrconsts:uemprocedurejump msgid "Procedure Jump" msgstr "Skok procedury" #: lazarusidestrconsts:uemclosepage msgid "&Close Page" msgstr "&Zavřít stránku" #: lazarusidestrconsts:uemcut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts:uemcopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:uempaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts:uemcopyfilename msgid "Copy filename" msgstr "Kopírovat soubor" #: lazarusidestrconsts:uemgotobookmark msgid "&Goto Bookmark" msgstr "&Skok na značku" #: lazarusidestrconsts:uemsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts:uemnextbookmark msgid "Goto next Bookmark" msgstr "" #: lazarusidestrconsts:uemprevbookmark msgid "Goto previous Bookmark" msgstr "" #: lazarusidestrconsts:uembookmarkn msgid "Bookmark" msgstr "Značka" #: lazarusidestrconsts:lischangeencoding msgid "Change Encoding" msgstr "Změnit kódování" #: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis2 msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts:lischangefile msgid "Change file" msgstr "Změnit soubor" #: lazarusidestrconsts:lisencodingoffileondiskisnewencodingis msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts:lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "" #: lazarusidestrconsts:lisabandonchanges msgid "Abandon changes?" msgstr "Zrušit změny?" #: lazarusidestrconsts:lisallyourmodificationstowillbelostandthefilereopened msgid "All your modifications to %s%s%s%swill be lost and the file reopened." msgstr "Všechny vaše úpravy v %s%s%s%s budou ztraceny a soubor bude otevřen znovu." #: lazarusidestrconsts:lisopenlfm msgid "Open %s" msgstr "Otevřít %s" #: lazarusidestrconsts:uemsetbookmark msgid "&Set Bookmark" msgstr "&Nastavit značku" #: lazarusidestrconsts:uemreadonly msgid "Read Only" msgstr "Pouze pro čtení" #: lazarusidestrconsts:uemshowlinenumbers msgid "Show Line Numbers" msgstr "" #: lazarusidestrconsts:uemshowunitinfo msgid "Unit Info" msgstr "Informace o jednotce" #: lazarusidestrconsts:uemdebugword msgid "Debug" msgstr "Ladění" #: lazarusidestrconsts:uemaddbreakpoint msgid "&Add Breakpoint" msgstr "&Přidat bod přerušení" #: lazarusidestrconsts:uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Přidat &Sledování v místě kurzoru" #: lazarusidestrconsts:uemruntocursor msgid "&Run to Cursor" msgstr "&Spustit po kurzor" #: lazarusidestrconsts:uemviewcallstack msgid "View Call Stack" msgstr "Zobrazit volací zásobník" #: lazarusidestrconsts:uemmoveeditorleft msgid "Move Editor Left" msgstr "" #: lazarusidestrconsts:uemmoveeditorright msgid "Move Editor Right" msgstr "" #: lazarusidestrconsts:uemmoveeditorleftmost msgid "Move Editor Leftmost" msgstr "" #: lazarusidestrconsts:uemmoveeditorrightmost msgid "Move Editor Rightmost" msgstr "" #: lazarusidestrconsts:uemrefactor msgid "Refactoring" msgstr "" #: lazarusidestrconsts:uemcompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts:uemencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts:uemextractproc msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts:ueminvertassignment msgid "Invert Assignment" msgstr "Převrátit přiřazení" #: lazarusidestrconsts:uemfindidentifierreferences msgid "Find Identifier References" msgstr "" #: lazarusidestrconsts:uemrenameidentifier msgid "Rename Identifier" msgstr "Přejmenovat identifikátor" #: lazarusidestrconsts:uemeditorproperties msgid "Editor properties" msgstr "Vlastnosti editoru" #: lazarusidestrconsts:uenotimplcap msgid "Not implemented yet" msgstr "Doposud neimplementováno" #: lazarusidestrconsts:uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" msgstr "Pošlete e-mail na lazarus@miraclec.com, pokud nám můžete pomoci implementovat tuto vlastnost." #: lazarusidestrconsts:uenotimplcapagain msgid "I told You: Not implemented yet" msgstr "Říkal jsem ti: Ještě není implementovano" #: lazarusidestrconsts:uefilerocap msgid "File is readonly" msgstr "Soubor je pouze ke čtení" #: lazarusidestrconsts:uefilerotext1 msgid "The file \"" msgstr "Soubor \"" #: lazarusidestrconsts:uefilerotext2 msgid "\" is not writable." msgstr "\" není zapisovatelný." #: lazarusidestrconsts:uemodified msgid "Modified" msgstr "Změněný" #: lazarusidestrconsts:uepreadonly msgid "Readonly" msgstr "Pouze pro čtení" #: lazarusidestrconsts:uepins msgid "INS" msgstr "" #: lazarusidestrconsts:uepovr msgid "OVR" msgstr "" #: lazarusidestrconsts:lisuefontwith msgid "Font without UTF-8" msgstr "Písmo bez UTF-8" #: lazarusidestrconsts:lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgstr "" #: lazarusidestrconsts:lisuedonotsho msgid "Do not show this message again." msgstr "Neukazovat znova tuto zprávu." #: lazarusidestrconsts:ueminserttodo msgid "Insert Todo" msgstr "Vložit úkol" #: lazarusidestrconsts:liscodehelpshowemptymethods msgid "Show empty methods" msgstr "Ukázat prázdné metody" #: lazarusidestrconsts:uemhighlighter msgid "Highlighter" msgstr "Zvýrazňovač" #: lazarusidestrconsts:uemencoding msgid "Encoding" msgstr "Kódování" #: lazarusidestrconsts:lisinvalidmultiselection msgid "Invalid multiselection" msgstr "Neplatný vícenásobný výběr" #: lazarusidestrconsts:lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "Nelze převést binární proud na text" #: lazarusidestrconsts:lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "" #: lazarusidestrconsts:liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "Nelze zkopírovat komponentu na nejvyšší úrovni." #: lazarusidestrconsts:liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "" #: lazarusidestrconsts:listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts:listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts:lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "Nelze zkopírovat komponenty do schránky" #: lazarusidestrconsts:listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "" #: lazarusidestrconsts:liserrorin msgid "Error in %s" msgstr "Chyba v %s" #: lazarusidestrconsts:lisdesthereisalreadyanothercomponentwiththename msgid "There is already another component with the name %s%s%s." msgstr "" #: lazarusidestrconsts:listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts:listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts:fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "" #: lazarusidestrconsts:lisinvaliddelete msgid "Invalid delete" msgstr "" #: lazarusidestrconsts:listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "" #: lazarusidestrconsts:listherootcomponentcannotbedeleted msgid "The root component can not be deleted." msgstr "" #: lazarusidestrconsts:fdmalignword msgid "Align" msgstr "Zarovnat" #: lazarusidestrconsts:fdmmirrorhorizontal msgid "Mirror horizontal" msgstr "Zrcadlit vodorovně" #: lazarusidestrconsts:fdmmirrorvertical msgid "Mirror vertical" msgstr "Zrcadlit svisle" #: lazarusidestrconsts:fdmscaleword msgid "Scale" msgstr "Měřítko" #: lazarusidestrconsts:fdmsizeword msgid "Size" msgstr "Velikost" #: lazarusidestrconsts:fdmtaborder msgid "Tab order..." msgstr "Pořadí záložek" #: lazarusidestrconsts:fdmorder msgid "Order" msgstr "Řadit" #: lazarusidestrconsts:fdmordermovetofront msgid "Move to front" msgstr "Přesunout dopředu" #: lazarusidestrconsts:fdmordermovetoback msgid "Move to back" msgstr "Přesunout dozadu" #: lazarusidestrconsts:fdmorderforwardone msgid "Forward one" msgstr "Dopředu o jedno" #: lazarusidestrconsts:fdmorderbackone msgid "Back one" msgstr "Zpět o jeden" #: lazarusidestrconsts:fdmdeleteselection msgid "Delete selection" msgstr "Odstranit výběr" #: lazarusidestrconsts:lischangeclass msgid "Change Class" msgstr "Změnit třídu" #: lazarusidestrconsts:fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "" #: lazarusidestrconsts:lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Zobrazit zdroj (.lfm)" #: lazarusidestrconsts:fdmsaveformasxml msgid "Save form as xml" msgstr "Uložit formulář jako xml" #: lazarusidestrconsts:fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "" #: lazarusidestrconsts:fdmshowoptions msgid "Show Options for form editing" msgstr "" #: lazarusidestrconsts:srkmeditkeys msgid "Edit Keys" msgstr "Upravit klávesy" #: lazarusidestrconsts:srkmcommand msgid "Command:" msgstr "Příkaz:" #: lazarusidestrconsts:liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts:listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" msgstr "" #: lazarusidestrconsts:lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "Alternativní klávesa (nebo sekvence dvou kláves)" #: lazarusidestrconsts:srkmconflic msgid "Conflict " msgstr "Konflikt" #: lazarusidestrconsts:srkmconflicw msgid " conflicts with " msgstr " konflikt s " #: lazarusidestrconsts:srkmcommand1 msgid " command1 \"" msgstr " příkaz1 \"" #: lazarusidestrconsts:srkmcommand2 msgid " command2 \"" msgstr " příkaz2 \"" #: lazarusidestrconsts:srkmeditforcmd msgid "Edit keys of command" msgstr "Upravit klávesy povelů" #: lazarusidestrconsts:lischooseakey msgid "Choose a key ..." msgstr "" #: lazarusidestrconsts:srkmkey msgid "Key (or 2 keys combination)" msgstr "" #: lazarusidestrconsts:srkmgrabkey msgid "Grab key" msgstr "" #: lazarusidestrconsts:srkmgrabsecondkey msgid "Grab second key" msgstr "" #: lazarusidestrconsts:srkmpresskey msgid "Please press a key ..." msgstr "Prosím stiskněte klávesu..." #: lazarusidestrconsts:srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "Alternativní klávesa (nebo kombinace dvou kláves)" #: lazarusidestrconsts:srkmalreadyconnected msgid " The key \"%s\" is already connected to \"%s\"." msgstr " Klíč \"%s\" již je připojen k \"%s\"." #: lazarusidestrconsts:srkmecwordleft msgid "Move cursor word left" msgstr "" #: lazarusidestrconsts:srkmecwordright msgid "Move cursor word right" msgstr "" #: lazarusidestrconsts:srkmeclinestart msgid "Move cursor to line start" msgstr "" #: lazarusidestrconsts:srkmeclineend msgid "Move cursor to line end" msgstr "" #: lazarusidestrconsts:srkmecpageup msgid "Move cursor up one page" msgstr "" #: lazarusidestrconsts:srkmecpagedown msgid "Move cursor down one page" msgstr "" #: lazarusidestrconsts:srkmecpageleft msgid "Move cursor left one page" msgstr "" #: lazarusidestrconsts:srkmecpageright msgid "Move cursor right one page" msgstr "" #: lazarusidestrconsts:srkmecpagetop msgid "Move cursor to top of page" msgstr "" #: lazarusidestrconsts:srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "" #: lazarusidestrconsts:srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "" #: lazarusidestrconsts:srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "" #: lazarusidestrconsts:srkmecgotoxy msgid "Goto XY" msgstr "" #: lazarusidestrconsts:srkmecselleft msgid "SelLeft" msgstr "" #: lazarusidestrconsts:srkmecselright msgid "SelRight" msgstr "" #: lazarusidestrconsts:srkmecselup msgid "Select Up" msgstr "" #: lazarusidestrconsts:srkmecseldown msgid "Select Down" msgstr "" #: lazarusidestrconsts:srkmecselwordleft msgid "Select Word Left" msgstr "" #: lazarusidestrconsts:srkmecselwordright msgid "Select Word Right" msgstr "" #: lazarusidestrconsts:srkmecsellinestart msgid "Select Line Start" msgstr "" #: lazarusidestrconsts:srkmecsellineend msgid "Select Line End" msgstr "" #: lazarusidestrconsts:srkmecselpageup msgid "Select Page Up" msgstr "" #: lazarusidestrconsts:srkmecselpagedown msgid "Select Page Down" msgstr "" #: lazarusidestrconsts:srkmecselpageleft msgid "Select Page Left" msgstr "" #: lazarusidestrconsts:srkmecselpageright msgid "Select Page Right" msgstr "" #: lazarusidestrconsts:srkmecselpagetop msgid "Select Page Top" msgstr "" #: lazarusidestrconsts:srkmecselpagebottom msgid "Select Page Bottom" msgstr "" #: lazarusidestrconsts:srkmecseleditortop msgid "Select to absolute beginning" msgstr "" #: lazarusidestrconsts:srkmecseleditorbottom msgid "Select to absolute end" msgstr "" #: lazarusidestrconsts:srkmecselgotoxy msgid "Select Goto XY" msgstr "" #: lazarusidestrconsts:srkmecselectall msgid "Select All" msgstr "Vybrat vše" #: lazarusidestrconsts:srkmecdeletelastchar msgid "Delete Last Char" msgstr "Odstratni poslední znak" #: lazarusidestrconsts:srkmecdeletechar msgid "Delete char at cursor" msgstr "Odstranit znak na pozici kurzoru" #: lazarusidestrconsts:srkmecdeleteword msgid "Delete to end of word" msgstr "Odstranit ke konci slova" #: lazarusidestrconsts:srkmecdeletelastword msgid "Delete to start of word" msgstr "Odstranit k začátku slova" #: lazarusidestrconsts:srkmecdeletebol msgid "Delete to beginning of line" msgstr "Odstranit k začátek řádku" #: lazarusidestrconsts:srkmecdeleteeol msgid "Delete to end of line" msgstr "Smazat ke konci řádku" #: lazarusidestrconsts:srkmecdeleteline msgid "Delete current line" msgstr "Odstranit aktuální řádek" #: lazarusidestrconsts:srkmecclearall msgid "Delete whole text" msgstr "Odstranit celý text" #: lazarusidestrconsts:srkmeclinebreak msgid "Break line and move cursor" msgstr "Ukončit řádek a přesunout kurzor" #: lazarusidestrconsts:srkmecinsertline msgid "Break line, leave cursor" msgstr "Ukončit řádek a nechat kurzor" #: lazarusidestrconsts:srkmecchar msgid "Char" msgstr "Znak" #: lazarusidestrconsts:srkmecimestr msgid "Ime Str" msgstr "" #: lazarusidestrconsts:srkmeccut msgid "Cut selection to clipboard" msgstr "Výjmout výběr do schránky" #: lazarusidestrconsts:srkmeccopy msgid "Copy selection to clipboard" msgstr "Zkopírovat výběr do schránky" #: lazarusidestrconsts:srkmecpaste msgid "Paste clipboard to current position" msgstr "Vložit schránku na aktuální pozici" #: lazarusidestrconsts:srkmecscrollup msgid "Scroll up one line" msgstr "" #: lazarusidestrconsts:srkmecscrolldown msgid "Scroll down one line" msgstr "" #: lazarusidestrconsts:srkmecscrollleft msgid "Scroll left one char" msgstr "" #: lazarusidestrconsts:srkmecscrollright msgid "Scroll right one char" msgstr "" #: lazarusidestrconsts:srkmecinsertmode msgid "Insert Mode" msgstr "Režim vkládání" #: lazarusidestrconsts:srkmecoverwritemode msgid "Overwrite Mode" msgstr "Režim přepisu" #: lazarusidestrconsts:srkmectogglemode msgid "Toggle Mode" msgstr "Přepnout režim" #: lazarusidestrconsts:srkmecblockindent msgid "Indent block" msgstr "Odsadit blok" #: lazarusidestrconsts:srkmecblockunindent msgid "Unindent block" msgstr "Vrátit odsazení bloku" #: lazarusidestrconsts:srkmecshifttab msgid "Shift Tab" msgstr "" #: lazarusidestrconsts:listab msgid "Tab" msgstr "" #: lazarusidestrconsts:srkmecmatchbracket msgid "Go to matching bracket" msgstr "" #: lazarusidestrconsts:srkmecnormalselect msgid "Normal selection mode" msgstr "" #: lazarusidestrconsts:srkmeccolumnselect msgid "Column selection mode" msgstr "Režim výběru sloupce" #: lazarusidestrconsts:srkmeclineselect msgid "Line selection mode" msgstr "" #: lazarusidestrconsts:srkmecautocompletion msgid "Code template completion" msgstr "" #: lazarusidestrconsts:srkmecuserfirst msgid "User First" msgstr "" #: lazarusidestrconsts:srkmecsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts:srkmecprevbookmark msgid "Previous Bookmark" msgstr "Předchozí značka" #: lazarusidestrconsts:srkmecnextbookmark msgid "Next Bookmark" msgstr "Další značka" #: lazarusidestrconsts:liskmgotomarker0 msgid "Go to marker 0" msgstr "Jít na značku 0" #: lazarusidestrconsts:liskmgotomarker1 msgid "Go to marker 1" msgstr "Jít na značku 1" #: lazarusidestrconsts:liskmgotomarker2 msgid "Go to marker 2" msgstr "Jít na značku 2" #: lazarusidestrconsts:liskmgotomarker3 msgid "Go to marker 3" msgstr "Jít na značku 3" #: lazarusidestrconsts:liskmgotomarker4 msgid "Go to marker 4" msgstr "Jít na značku 4" #: lazarusidestrconsts:liskmgotomarker5 msgid "Go to marker 5" msgstr "Jít na značku 5" #: lazarusidestrconsts:liskmgotomarker6 msgid "Go to marker 6" msgstr "Jít na značku 6" #: lazarusidestrconsts:liskmgotomarker7 msgid "Go to marker 7" msgstr "Jít na značku 7" #: lazarusidestrconsts:liskmgotomarker8 msgid "Go to marker 8" msgstr "Jít na značku 8" #: lazarusidestrconsts:liskmgotomarker9 msgid "Go to marker 9" msgstr "Jít na značku 9" #: lazarusidestrconsts:liskmsetmarker0 msgid "Set marker 0" msgstr "Nastavit značku 0" #: lazarusidestrconsts:liskmsetmarker1 msgid "Set marker 1" msgstr "Nastavit značku 1" #: lazarusidestrconsts:liskmsetmarker2 msgid "Set marker 2" msgstr "Nastavit značku 2" #: lazarusidestrconsts:liskmsetmarker3 msgid "Set marker 3" msgstr "Nastavit značku 3" #: lazarusidestrconsts:liskmsetmarker4 msgid "Set marker 4" msgstr "Nastavit značku 4" #: lazarusidestrconsts:liskmsetmarker5 msgid "Set marker 5" msgstr "Nastavit značku 5" #: lazarusidestrconsts:liskmsetmarker6 msgid "Set marker 6" msgstr "Nastavit značku 6" #: lazarusidestrconsts:liskmsetmarker7 msgid "Set marker 7" msgstr "Nastavit značku 7" #: lazarusidestrconsts:liskmsetmarker8 msgid "Set marker 8" msgstr "Nastavit značku 8" #: lazarusidestrconsts:liskmsetmarker9 msgid "Set marker 9" msgstr "Nastavit značku 9" #: lazarusidestrconsts:srkmecgotomarker msgid "Go to Marker %d" msgstr "Jít na značku %d" #: lazarusidestrconsts:srkmecsetmarker msgid "Set Marker %d" msgstr "Nastavit značku %d" #: lazarusidestrconsts:srkmecjumptoeditor msgid "Focus to source editor" msgstr "" #: lazarusidestrconsts:liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "" #: lazarusidestrconsts:srkmecnexteditor msgid "Go to next editor" msgstr "" #: lazarusidestrconsts:srkmecpreveditor msgid "Go to prior editor" msgstr "" #: lazarusidestrconsts:liskmaddbreakpoint msgid "Add break point" msgstr "Přidat bod přerušení" #: lazarusidestrconsts:liskmremovebreakpoint msgid "Remove break point" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorleft msgid "Move editor left" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorright msgid "Move editor right" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "" #: lazarusidestrconsts:srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "" #: lazarusidestrconsts:liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "" #: lazarusidestrconsts:srkmecgotoeditor msgid "Go to editor %d" msgstr "" #: lazarusidestrconsts:srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Převést ve výběru tabulátory na mezery " #: lazarusidestrconsts:liskmencloseselection msgid "Enclose selection" msgstr "" #: lazarusidestrconsts:srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "" #: lazarusidestrconsts:srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "" #: lazarusidestrconsts:srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "" #: lazarusidestrconsts:srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts:liskminsertusername msgid "Insert username" msgstr "" #: lazarusidestrconsts:liskminsertdateandtime msgid "Insert date and time" msgstr "" #: lazarusidestrconsts:srkmecinsertusername msgid "Insert current username" msgstr "" #: lazarusidestrconsts:srkmecinsertdatetime msgid "Insert current date and time" msgstr "" #: lazarusidestrconsts:srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "" #: lazarusidestrconsts:srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "" #: lazarusidestrconsts:srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "" #: lazarusidestrconsts:srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "" #: lazarusidestrconsts:srkmecinsertguid msgid "Insert a GUID" msgstr "" #: lazarusidestrconsts:srkmecfind msgid "Find text" msgstr "Najít text" #: lazarusidestrconsts:srkmecfindnext msgid "Find next" msgstr "Najít další" #: lazarusidestrconsts:srkmecfindprevious msgid "Find previous" msgstr "Najít předchozí" #: lazarusidestrconsts:srkmecfindinfiles msgid "Find in files" msgstr "Najít v souborech" #: lazarusidestrconsts:srkmecreplace msgid "Replace text" msgstr "Nahradit text" #: lazarusidestrconsts:liskmfindincremental msgid "Find incremental" msgstr "" #: lazarusidestrconsts:srkmecfindproceduredefinition msgid "Find procedure definiton" msgstr "Najít definic procedury" #: lazarusidestrconsts:srkmecfindproceduremethod msgid "Find procedure method" msgstr "" #: lazarusidestrconsts:srkmecgotolinenumber msgid "Go to line number" msgstr "Jít na číslo řádku" #: lazarusidestrconsts:srkmecfindnextwordoccurrence msgid "Find next word occurrence" msgstr "Najít další výskyt slova" #: lazarusidestrconsts:srkmecfindprevwordoccurrence msgid "Find previous word occurrence" msgstr "Najít předchozí výskyt slova" #: lazarusidestrconsts:srkmecaddjumppoint msgid "Add jump point" msgstr "Přidat bod skoku" #: lazarusidestrconsts:liskmviewjumphistory msgid "View jump history" msgstr "Zobrazit historii skoků" #: lazarusidestrconsts:srkmecopenfileatcursor msgid "Open file at cursor" msgstr "Otevřít soubor na pozici kurzoru" #: lazarusidestrconsts:srkmecgotoincludedirective msgid "Go to to include directive of current include file" msgstr "" #: lazarusidestrconsts:srkmecprocedurelist msgid "Procedure List ..." msgstr "Seznam procedůr..." #: lazarusidestrconsts:srkmectoggleformunit msgid "Switch between form and unit" msgstr "Přepnout mezi formulářem a jednotkou" #: lazarusidestrconsts:srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Zobrazit inspektor objektů" #: lazarusidestrconsts:srkmectogglesourceeditor msgid "View Source Editor" msgstr "Zobrazit editor zdrojů" #: lazarusidestrconsts:srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Zobrazit průzkumník kódu" #: lazarusidestrconsts:srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "Zobrazit editor dokumentace" #: lazarusidestrconsts:srkmectogglemessages msgid "View messages" msgstr "Zobrazit hlášení" #: lazarusidestrconsts:srkmectogglesearchresults msgid "View Search Results" msgstr "Zobrazit výsledky hledání" #: lazarusidestrconsts:srkmectogglewatches msgid "View watches" msgstr "Zobrazit sledovače" #: lazarusidestrconsts:srkmectogglebreakpoints msgid "View breakpoints" msgstr "Zobrazit body zastavení" #: lazarusidestrconsts:srkmectoggledebuggerout msgid "View debugger output" msgstr "Zobrazit výstup ladícího nástroje" #: lazarusidestrconsts:srkmectogglelocals msgid "View local variables" msgstr "Zobrazi místní proměnné" #: lazarusidestrconsts:srkmectogglecallstack msgid "View call stack" msgstr "Zobrazit volací zásobník" #: lazarusidestrconsts:srkmecviewunits msgid "View units" msgstr "Zobrazit jednotky" #: lazarusidestrconsts:srkmecviewforms msgid "View forms" msgstr "Zobrazit formuláře" #: lazarusidestrconsts:srkmecviewcomponents msgid "View components" msgstr "Zobrazit komponenty" #: lazarusidestrconsts:srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Zobrazit závislosti jednotky" #: lazarusidestrconsts:srkmecviewunitinfo msgid "View unit information" msgstr "Zobrazit informace o jednotkách" #: lazarusidestrconsts:srkmecviewanchoreditor msgid "View anchor editor" msgstr "Zobrazit editor kotev" #: lazarusidestrconsts:srkmectogglecodebrowser msgid "View code browser" msgstr "Zobrazit prohlížeč kódu" #: lazarusidestrconsts:srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "Zobrazit prohlížeč omezení" #: lazarusidestrconsts:srkmectogglecomppalette msgid "View component palette" msgstr "Zobrazit sadu komponent" #: lazarusidestrconsts:srkmectoggleidespeedbtns msgid "View IDE speed buttons" msgstr "Zobrazit rychlé tlačítka IDE" #: lazarusidestrconsts:srkmecviewtodolist msgid "View todo list" msgstr "Zobrazit seznam úkolů" #: lazarusidestrconsts:srkmecwordcompletion msgid "Word completion" msgstr "Doplnění slova" #: lazarusidestrconsts:srkmeccompletecode msgid "Complete code" msgstr "Dokončení kódu" #: lazarusidestrconsts:srkmecshowcodecontext msgid "Show code context" msgstr "Ukázat obsah kódu" #: lazarusidestrconsts:srkmecextractproc msgid "Extract procedure" msgstr "" #: lazarusidestrconsts:srkmecfindidentifierrefs msgid "Find identifier references" msgstr "" #: lazarusidestrconsts:srkmecrenameidentifier msgid "Rename identifier" msgstr "" #: lazarusidestrconsts:srkmecinvertassignment msgid "Invert assignment" msgstr "" #: lazarusidestrconsts:srkmecsyntaxcheck msgid "Syntax check" msgstr "" #: lazarusidestrconsts:srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" msgstr "" #: lazarusidestrconsts:srkmecfinddeclaration msgid "Find declaration" msgstr "Najít deklaraci" #: lazarusidestrconsts:srkmecfindblockotherend msgid "Find block other end" msgstr "Najít další konec bloku" #: lazarusidestrconsts:srkmecfindblockstart msgid "Find block start" msgstr "Najít začátek bloku" #: lazarusidestrconsts:srkmecshowabstractmethods msgid "Show abstract methods" msgstr "Ukázat abstraktní metody" #: lazarusidestrconsts:srkmecremoveemptymethods msgid "Remove empty methods" msgstr "Odebrat prázdné metody" #: lazarusidestrconsts:srkmecbuild msgid "build program/project" msgstr "Sestavit program/projekt" #: lazarusidestrconsts:srkmecbuildall msgid "build all files of program/project" msgstr "sestavit všechny soubory programu/projektu" #: lazarusidestrconsts:srkmecquickcompile msgid "quick compile, no linking" msgstr "rychlý překlad, bez spojení" #: lazarusidestrconsts:srkmecabortbuild msgid "abort build" msgstr "přerušit sestavení" #: lazarusidestrconsts:srkmecrun msgid "run program" msgstr "spustit program" #: lazarusidestrconsts:srkmecpause msgid "pause program" msgstr "pozastavit program" #: lazarusidestrconsts:srkmecstopprogram msgid "stop program" msgstr "zastavit program" #: lazarusidestrconsts:srkmecresetdebugger msgid "reset debugger" msgstr "resetovat ladič" #: lazarusidestrconsts:srkmecaddbreakpoint msgid "add break point" msgstr "přidat bod přerušení" #: lazarusidestrconsts:srkmecremovebreakpoint msgid "remove break point" msgstr "odebrat bod přerušení" #: lazarusidestrconsts:srkmecrunparameters msgid "run parameters" msgstr "spustit s parametry" #: lazarusidestrconsts:srkmeccompileroptions msgid "compiler options" msgstr "volby překladače" #: lazarusidestrconsts:srkmecbuildfile msgid "build file" msgstr "sestavit soubor" #: lazarusidestrconsts:srkmecrunfile msgid "run file" msgstr "spustit soubor" #: lazarusidestrconsts:srkmecconfigbuildfile msgid "config build file" msgstr "konfigurační soubor sestavení" #: lazarusidestrconsts:srkmecinspect msgid "inspect" msgstr "" #: lazarusidestrconsts:srkmecevaluate msgid "evaluate/modify" msgstr "vyhodnocení/upravení" #: lazarusidestrconsts:srkmecaddwatch msgid "add watch" msgstr "přidat sledování" #: lazarusidestrconsts:srkmecexttoolsettings msgid "External tools settings" msgstr "" #: lazarusidestrconsts:srkmecbuildlazarus msgid "Build lazarus" msgstr "Sestavit lazarus" #: lazarusidestrconsts:srkmecexttool msgid "External tool %d" msgstr "" #: lazarusidestrconsts:srkmeccustomtool msgid "Custom tool %d" msgstr "" #: lazarusidestrconsts:srkmecenvironmentoptions msgid "General environment options" msgstr "Obecná nastavení prostředí" #: lazarusidestrconsts:liskmeditoroptions msgid "Editor options" msgstr "Nastavení editoru" #: lazarusidestrconsts:liskmeditcodetemplates msgid "Edit Code Templates" msgstr "Upravit šablony kódů" #: lazarusidestrconsts:liskmcodetoolsoptions msgid "CodeTools options" msgstr "" #: lazarusidestrconsts:liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "" #: lazarusidestrconsts:srkmeccodetoolsoptions msgid "Codetools options" msgstr "" #: lazarusidestrconsts:srkmeccodetoolsdefinesed msgid "Codetools defines editor" msgstr "" #: lazarusidestrconsts:lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" msgstr "" #: lazarusidestrconsts:srkmecmakeresourcestring msgid "Make resource string" msgstr "" #: lazarusidestrconsts:liskmdiffeditorfiles msgid "Diff editor files" msgstr "Rozdíl editovaných souborů" #: lazarusidestrconsts:liskmconvertdfmfiletolfm msgid "Convert DFM file to LFM" msgstr "Převést DFM soubor na LFM" #: lazarusidestrconsts:liskmconvertdelphiunittolazarusunit msgid "Convert Delphi unit to Lazarus unit" msgstr "Převést Delphi jednotku na Lazarus jednotku" #: lazarusidestrconsts:liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi project to Lazarus project" msgstr "Převést Delphi projekt na Lazarus projekt" #: lazarusidestrconsts:srkmecdiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts:srkmecunknown msgid "unknown editor command" msgstr "neznámý příkaz editoru" #: lazarusidestrconsts:srkmcatcursormoving msgid "Cursor moving commands" msgstr "" #: lazarusidestrconsts:srkmcatselection msgid "Text selection commands" msgstr "Příkazy výběru textu" #: lazarusidestrconsts:srkmcatediting msgid "Text editing commands" msgstr "Příkazy editace textu" #: lazarusidestrconsts:liskmdeletelastchar msgid "Delete last char" msgstr "Odstranit poslední znak" #: lazarusidestrconsts:srkmcatcmdcmd msgid "Command commands" msgstr "" #: lazarusidestrconsts:srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Příkazy hledání a nahrazení textu" #: lazarusidestrconsts:srkmcatmarker msgid "Text marker commands" msgstr "Příkazy označení textu" #: lazarusidestrconsts:liskmsetfreebookmark msgid "Set free Bookmark" msgstr "" #: lazarusidestrconsts:srkmcatcodetools msgid "CodeTools commands" msgstr "" #: lazarusidestrconsts:srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "" #: lazarusidestrconsts:srkmcatfilemenu msgid "File menu commands" msgstr "Příkazy menu Soubor" #: lazarusidestrconsts:liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "" #: lazarusidestrconsts:srkmcatviewmenu msgid "View menu commands" msgstr "Zobrazit příkazy menu" #: lazarusidestrconsts:liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "" #: lazarusidestrconsts:liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "" #: lazarusidestrconsts:liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "" #: lazarusidestrconsts:liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "" #: lazarusidestrconsts:liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "" #: lazarusidestrconsts:liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "" #: lazarusidestrconsts:liskmtoggleviewwatches msgid "Toggle view Watches" msgstr "" #: lazarusidestrconsts:liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" msgstr "" #: lazarusidestrconsts:liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" msgstr "" #: lazarusidestrconsts:liskmtoggleviewcallstack msgid "Toggle view Call Stack" msgstr "" #: lazarusidestrconsts:liskmtoggleviewdebuggeroutput msgid "Toggle view Debugger Output" msgstr "" #: lazarusidestrconsts:srkmcatprojectmenu msgid "Project menu commands" msgstr "Příkazy menu Projekt" #: lazarusidestrconsts:liskmnewproject msgid "New project" msgstr "Nový projekt" #: lazarusidestrconsts:liskmnewprojectfromfile msgid "New project from file" msgstr "Nový projekt ze souboru" #: lazarusidestrconsts:liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "" #: lazarusidestrconsts:srkmcatrunmenu msgid "Run menu commands" msgstr "Spustit příkazy menu" #: lazarusidestrconsts:liskmbuildprojectprogram msgid "Build project/program" msgstr "Sestavit projekt/program" #: lazarusidestrconsts:liskmbuildallfilesofprojectprogram msgid "Build all files of project/program" msgstr "Sestavit všechny soubory projektu/programu" #: lazarusidestrconsts:liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "" #: lazarusidestrconsts:liskmabortbuilding msgid "Abort building" msgstr "Přerušit sestavování" #: lazarusidestrconsts:liskmrunprogram msgid "Run program" msgstr "Spustit program" #: lazarusidestrconsts:liskmpauseprogram msgid "Pause program" msgstr "Pozastavit program" #: lazarusidestrconsts:liskmviewprojectoptions msgid "View project options" msgstr "Zobrazit nastavení projektu" #: lazarusidestrconsts:srkmcatpackagemenu msgid "Package menu commands" msgstr "Příkazy menu Balíček" #: lazarusidestrconsts:srkmcattoolmenu msgid "Tools menu commands" msgstr "Příkazy menu Nástroje" #: lazarusidestrconsts:liskmexternaltoolssettings msgid "External Tools settings" msgstr "Nastavení vnějších nástrojů" #: lazarusidestrconsts:srkmcatenvmenu msgid "Environment menu commands" msgstr "Příkazy menu pro prostředí " #: lazarusidestrconsts:liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "Převést Delphi balíček na Lazarus balíček" #: lazarusidestrconsts:srkmcarhelpmenu msgid "Help menu commands" msgstr "Příkazy menu Nápověda" #: lazarusidestrconsts:liskeycatdesigner msgid "Designer commands" msgstr "Povely návrháře" #: lazarusidestrconsts:liskmcopyselectedcomponentstoclipboard msgid "Copy selected Components to clipboard" msgstr "Zkopírovat vybrané komponenty do schránky" #: lazarusidestrconsts:liskmcutselectedcomponentstoclipboard msgid "Cut selected Components to clipboard" msgstr "Výjmout vybrané komponenty do schránky" #: lazarusidestrconsts:liskmpastecomponentsfromclipboard msgid "Paste Components from clipboard" msgstr "Vložit komponenty ze schránky" #: lazarusidestrconsts:liskeycatobjinspector msgid "Object Inspector commands" msgstr "Příkazy inspektoru objektů" #: lazarusidestrconsts:liskeycatcustom msgid "Custom commands" msgstr "Vlastní příkazy" #: lazarusidestrconsts:rslanguageautomatic msgid "Automatic (or english)" msgstr "Automaticky (nebo angličtina)" #: lazarusidestrconsts:rslanguageenglish msgid "English" msgstr "Anglicky" #: lazarusidestrconsts:rslanguagegerman msgid "German" msgstr "Německy" #: lazarusidestrconsts:rslanguagespanish msgid "Spanish" msgstr "Španělsky" #: lazarusidestrconsts:rslanguagefrench msgid "French" msgstr "Francouzky" #: lazarusidestrconsts:rslanguagerussian msgid "Russian" msgstr "Rusky" #: lazarusidestrconsts:rslanguagepolish msgid "Polish" msgstr "Polsky" #: lazarusidestrconsts:rslanguagepolishiso msgid "Polish(ISO 8859-2)" msgstr "Polsky(ISO 8859-2)" #: lazarusidestrconsts:rslanguagepolishwin msgid "Polish(CP1250)" msgstr "Polsky(CP1250)" #: lazarusidestrconsts:rslanguageitalian msgid "Italian" msgstr "Italsky" #: lazarusidestrconsts:rslanguagecatalan msgid "Catalan" msgstr "Katalánky" #: lazarusidestrconsts:rslanguagefinnish msgid "Finnish" msgstr "Finsky" #: lazarusidestrconsts:rslanguagehebrew msgid "Hebrew" msgstr "Hebrejsky" #: lazarusidestrconsts:rslanguagearabic msgid "Arabic" msgstr "Arabština" #: lazarusidestrconsts:rslanguageportugues msgid "Portuguese" msgstr "Portugalsky" #: lazarusidestrconsts:rslanguageukrainian msgid "Ukrainian" msgstr "Ukrajinsky" #: lazarusidestrconsts:rslanguagedutch msgid "Dutch" msgstr "Němčina" #: lazarusidestrconsts:rslanguagejapanese msgid "Japanese" msgstr "Japonsky" #: lazarusidestrconsts:rslanguagechinese msgid "Chinese" msgstr "Čínsky" #: lazarusidestrconsts:rslanguageindonesian msgid "Indonesian" msgstr "Indonésky" #: lazarusidestrconsts:rslanguageafrikaans msgid "Afrikaans" msgstr "Afrikánština" #: lazarusidestrconsts:rslanguagelithuanian msgid "Lithuanian" msgstr "Litevsky" #: lazarusidestrconsts:rslanguageslovak msgid "Slovak" msgstr "Slovensky" #: lazarusidestrconsts:rslanguageturkish msgid "Turkish" msgstr "Turecky" #: lazarusidestrconsts:dlgunitdepcaption msgid "Unit dependencies" msgstr "Závislosti jednotky" #: lazarusidestrconsts:dlgunitdepbrowse msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts:dlgunitdeprefresh msgid "Refresh" msgstr "Obnovit" #: lazarusidestrconsts:lisprint msgid "Print" msgstr "Tisknout" #: lazarusidestrconsts:listodogoto msgid "Goto" msgstr "Přejít" #: lazarusidestrconsts:lisdocumentationeditor msgid "Documentation Editor" msgstr "Editor dokumentace" #: lazarusidestrconsts:lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" msgstr "Chcete znovu sestavit Lazarus?" #: lazarusidestrconsts:liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Vyčistit zdrojové soubory Lazarusu" #: lazarusidestrconsts:lismakenotfound msgid "Make not found" msgstr "Nenalezen Make" #: lazarusidestrconsts:listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" msgstr "" #: lazarusidestrconsts:liscompileidewithoutlinking msgid "Compile IDE (without linking)" msgstr "Přeložit IDE (bez vazeb)" #: lazarusidestrconsts:lislcl msgid "LCL" msgstr "LCL" #: lazarusidestrconsts:liscomponent msgid "Component" msgstr "Komponenta" #: lazarusidestrconsts:liscodetools msgid "CodeTools" msgstr "" #: lazarusidestrconsts:lissynedit msgid "SynEdit" msgstr "" #: lazarusidestrconsts:lisideintf msgid "IDE Interface" msgstr "" #: lazarusidestrconsts:lisjitform msgid "JIT Form" msgstr "" #: lazarusidestrconsts:lispkgreg msgid "Package Registration" msgstr "Registrace balíčku" #: lazarusidestrconsts:liside msgid "IDE" msgstr "IDE" #: lazarusidestrconsts:lisexamples msgid "Examples" msgstr "Příklady" #: lazarusidestrconsts:lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" msgstr "Nastavení %sSestavení Lazarusu%s" #: lazarusidestrconsts:lislazbuildcleanall msgid "Clean all" msgstr "Vyčistit vše" #: lazarusidestrconsts:lislazbuildbuildcomponentssyneditcodetools msgid "Build components (SynEdit, CodeTools)" msgstr "Sestavit komponenty (SynEdit, CodeTools)" #: lazarusidestrconsts:lislazbuildbuildsynedit msgid "Build SynEdit" msgstr "Sestavit SynEdit" #: lazarusidestrconsts:lislazbuildbuildcodetools msgid "Build CodeTools" msgstr "Sestavit kódové nástroje" #: lazarusidestrconsts:lislazbuildbuildide msgid "Build IDE" msgstr "Sestavit IDE" #: lazarusidestrconsts:lislazbuildbuildexamples msgid "Build examples" msgstr "Sestavit příklady" #: lazarusidestrconsts:lislazbuildoptions msgid "Options:" msgstr "Nastavení:" #: lazarusidestrconsts:lislazbuildtargetos msgid "Target OS:" msgstr "Cílový OS:" #: lazarusidestrconsts:lislazbuildtargetcpu msgid "Target CPU:" msgstr "Cílové CPU" #: lazarusidestrconsts:lislazbuildtargetdirectory msgid "Target directory:" msgstr "Cílový adresář:" #: lazarusidestrconsts:lislazbuildlclinterface msgid "LCL interface" msgstr "Rozhranní LCL" #: lazarusidestrconsts:lislazbuildbuildjitform msgid "Build JITForm" msgstr "Sestavit JITForm" #: lazarusidestrconsts:lislazbuildwithstaticpackages msgid "With packages" msgstr "S balíčky" #: lazarusidestrconsts:lislazbuildrestartafterbuild msgid "Restart after successful Build" msgstr "Restartovat po úspěšném sestavení" #: lazarusidestrconsts:lislazbuildconfirmbuild msgid "Confirm before rebuilding Lazarus" msgstr "Potvrdit přes znovusestavením Lazarusu" #: lazarusidestrconsts:lislazbuildok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts:lisctdtemplates msgid "Templates" msgstr "Šablony" #: lazarusidestrconsts:lissavesettings msgid "Save Settings" msgstr "Uložit nastavení" #: lazarusidestrconsts:lislazbuildcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts:lislazbuildnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts:lislazbuildbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts:lislazbuildcleanbuild msgid "Clean+Build" msgstr "Vyčistit + Sestavit" #: lazarusidestrconsts:lislazbuildbuildoptions msgid "Build Options" msgstr "Volby sestavení" #: lazarusidestrconsts:lislazbuilderrorwritingfile msgid "Error writing file" msgstr "Chyba zapisování souboru" #: lazarusidestrconsts:lislazbuildunabletowritefile msgid "Unable to write file \"%s\":%s" msgstr "Nelze zapisovat do souboru \"%s\":%s" #: lazarusidestrconsts:lislazbuildquickbuildoptions msgid "Quick Build Options" msgstr "Volby rychlého sestavení" #: lazarusidestrconsts:lislazbuildqbobuildlcl msgid "Build LCL" msgstr "Sestavit LCL" #: lazarusidestrconsts:lislazbuildqbobuildidewpackages msgid "Build IDE with Packages" msgstr "Sestavit IDE s balíčky" #: lazarusidestrconsts:lislazbuildqbobuildidewithoutpackages msgid "Build IDE without Packages" msgstr "Sestavit IDE bez balíčků" #: lazarusidestrconsts:lislazbuildqbobuildall msgid "Build All" msgstr "Sestavit vše" #: lazarusidestrconsts:lislazbuildqbocleanupbuildall msgid "Clean Up + Build all" msgstr "Vyčistit + Sestavit vše" #: lazarusidestrconsts:lislazbuildqbobuildother msgid "Other" msgstr "Jiné" #: lazarusidestrconsts:lislazbuildqboapplcltarget msgid "Target" msgstr "Cíl" #: lazarusidestrconsts:lislazbuildadvancedbuildoptions msgid "Advanced Build Options" msgstr "Pokročilé volby sestavení" #: lazarusidestrconsts:lislazbuildabopart msgid "Part" msgstr "Část" #: lazarusidestrconsts:lislazbuildaboaction msgid "Action" msgstr "Akce" #: lazarusidestrconsts:lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "" #: lazarusidestrconsts:liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" msgstr "Chyba: neplatný kompilátor: %s" #: lazarusidestrconsts:listcompilerinternalerror msgid "Internal compiler error! (%d)" msgstr "" #: lazarusidestrconsts:liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgstr "" #: lazarusidestrconsts:liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "" #: lazarusidestrconsts:liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "" #: lazarusidestrconsts:liscodetoolsoptsok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts:liscodetoolsoptsnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts:liscodetoolsoptskeyword msgid "Keyword" msgstr "Klíčové slovo" #: lazarusidestrconsts:liscodetoolsoptsidentifier msgid "Identifier" msgstr "Identifikátor" #: lazarusidestrconsts:lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Doplňující soubory k vyhledání (napč. /path/*.pas;/path2/*.pp)" #: lazarusidestrconsts:lisfrifindreferences msgid "Find References" msgstr "Najít odkazy" #: lazarusidestrconsts:lisfriinvalididentifier msgid "Invalid Identifier" msgstr "Neplatný identifikátor" #: lazarusidestrconsts:lisfrirenameto msgid "Rename to" msgstr "Přejmenovat na" #: lazarusidestrconsts:lisfrirename msgid "Rename" msgstr "Přejmenování" #: lazarusidestrconsts:lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Hledat také v komentářích" #: lazarusidestrconsts:lisfrisearchwhere msgid "Search where" msgstr "Kde hledat" #: lazarusidestrconsts:liscodetoolsoptscolon msgid "Colon" msgstr "Dvojtečka" #: lazarusidestrconsts:liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Středník" #: lazarusidestrconsts:liscodetoolsoptscomma msgid "Comma" msgstr "Čárka" #: lazarusidestrconsts:liscodetoolsoptspoint msgid "Point" msgstr "Bod" #: lazarusidestrconsts:liscodetoolsoptsat msgid "At" msgstr "u" #: lazarusidestrconsts:liscodetoolsoptsnumber msgid "Number" msgstr "Číslo" #: lazarusidestrconsts:liscodetoolsoptsstringconst msgid "String constant" msgstr "Konstantní řetězec" #: lazarusidestrconsts:liscodetoolsoptsnewline msgid "Newline" msgstr "Nový řádek" #: lazarusidestrconsts:liscodetoolsoptsspace msgid "Space" msgstr "Mezera" #: lazarusidestrconsts:liscodetoolsoptssymbol msgid "Symbol" msgstr "Symbol" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" msgstr "" #: lazarusidestrconsts:liscodetoolsdefswriteerror msgid "Write error" msgstr "Chyba zápisu" #: lazarusidestrconsts:lisstopdebugging2 msgid "Stop debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts:lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Zastavit aktuální ladění a znovu sestavit projekt?" #: lazarusidestrconsts:liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "Cyba zápisu seznamu balíčků do souboru%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" msgstr "Chyba během zapisování %s%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" msgstr "Chyba během zapisování informačního souboru projektu %s%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefsreaderror msgid "Read error" msgstr "Chyba čtení" #: lazarusidestrconsts:lisunabletoread msgid "Unable to read %s" msgstr "Nelze přečíst %s" #: lazarusidestrconsts:liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "Chyba načítání seznamu balíčků ze souboru%s%s%s%s" #: lazarusidestrconsts:listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." msgstr "" #: lazarusidestrconsts:lislclunitpathmissing msgid "LCL unit path missing" msgstr "" #: lazarusidestrconsts:lisnotadelphiunit msgid "Not a Delphi unit" msgstr "Není jednotka Delphi" #: lazarusidestrconsts:listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." msgstr "Soubor %s%s%s není Delphi jednotka." #: lazarusidestrconsts:liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" msgstr "Chyba čtení %s%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" msgstr "Chyba čtení informací o projektu ze souboru %s%s%s%s%s" #: lazarusidestrconsts:liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." msgstr "Automaticky generované uzly nelze editovat." #: lazarusidestrconsts:liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "" #: lazarusidestrconsts:liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "Adresář projektu Free Pascalu." #: lazarusidestrconsts:liscodetoolsdefscompilerpath msgid "compiler path" msgstr "Cesta překladače" #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC SVN source directory" msgstr "SVN zdrojový adresář FPC" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal SVN Sources" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal SVN source directory." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdirectory msgid "%s directory" msgstr "%s složka" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsprojectdirectory2 msgid "%s project directory" msgstr "%s složka projektu" #: lazarusidestrconsts:liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsexit msgid "Exit" msgstr "Ukončit" #: lazarusidestrconsts:liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "Uložit a ukončit" #: lazarusidestrconsts:liscodetoolsdefsexitwithoutsave msgid "Exit without Save" msgstr "Ukončit bez uložení" #: lazarusidestrconsts:liscodetoolsdefsedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts:liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Odstranit uzel" #: lazarusidestrconsts:liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Převést uzel" #: lazarusidestrconsts:liscodetoolsdefsdefine msgid "Define" msgstr "Defiovat" #: lazarusidestrconsts:liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "Definovat rekurentně" #: lazarusidestrconsts:liscodetoolsdefsundefine msgid "Undefine" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsundefineall msgid "Undefine All" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsblock msgid "Block" msgstr "Blok" #: lazarusidestrconsts:liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Složka" #: lazarusidestrconsts:liscodetoolsdefsif msgid "If" msgstr "Pokud" #: lazarusidestrconsts:liscodetoolsdefsifdef msgid "IfDef" msgstr "PokudDefinováno" #: lazarusidestrconsts:liscodetoolsdefsifndef msgid "IfNDef" msgstr "PokudNedefinováno" #: lazarusidestrconsts:liscodetoolsdefselseif msgid "ElseIf" msgstr "JinakPokud" #: lazarusidestrconsts:liscodetoolsdefselse msgid "Else" msgstr "Jinak" #: lazarusidestrconsts:lisctdefstools msgid "Tools" msgstr "Nástroje" #: lazarusidestrconsts:lisctdefsopenpreview msgid "Open Preview" msgstr "Otevřít náhled" #: lazarusidestrconsts:liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "Vložit šablonu" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Vybrat uzel:" #: lazarusidestrconsts:liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts:liscodetoolsdefsdescription msgid "Description:" msgstr "Popis:" #: lazarusidestrconsts:liscodetoolsdefsvariable msgid "Variable:" msgstr "Proměnná:" #: lazarusidestrconsts:liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Hodnota jako text" #: lazarusidestrconsts:liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "Hodnota jako cesty souboru" #: lazarusidestrconsts:liscodetoolsdefsaction msgid "Action: %s" msgstr "Akce: %s" #: lazarusidestrconsts:liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "%s, automaticky generováno" #: lazarusidestrconsts:liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "%s, údaje projektu" #: lazarusidestrconsts:liscodetoolsdefsnoneselected msgid "none selected" msgstr "žádné vybrané" #: lazarusidestrconsts:liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "neplatný rodič" #: lazarusidestrconsts:lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze negrafické komponenty." #: lazarusidestrconsts:liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůže mít neautomaticky vytvořené uzly potomků." #: lazarusidestrconsts:liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "" #: lazarusidestrconsts:liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." msgstr "" #: lazarusidestrconsts:liscodetoolsdefsnewnode msgid "NewNode" msgstr "Nový uzel" #: lazarusidestrconsts:liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "" #: lazarusidestrconsts:liscodetempladdcodetemplate msgid "Add code template" msgstr "Přidat šablonu kódu" #: lazarusidestrconsts:liscodetempladd msgid "Add" msgstr "Přidat" #: lazarusidestrconsts:liscodetempleditcodetemplate msgid "Edit code template" msgstr "Upravit šablonu kódu" #: lazarusidestrconsts:liscodetemplautocompleteon msgid "Auto complete on ..." msgstr "Automatické dokončení na ..." #: lazarusidestrconsts:liscodetemplchange msgid "Change" msgstr "Změnit" #: lazarusidestrconsts:liscodetempltoken msgid "Token:" msgstr "" #: lazarusidestrconsts:liscodetemplcomment msgid "Comment:" msgstr "Komentář:" #: lazarusidestrconsts:liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " msgstr " Symbol %s%s%s již existuje! " #: lazarusidestrconsts:liscodetemplerror msgid "Error" msgstr "Chyba" #: lazarusidestrconsts:lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule." #: lazarusidestrconsts:lisclassconflictswithlfmfiletheunitusestheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." msgstr "" #: lazarusidestrconsts:lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." msgstr "Nelze načíst třídu komponenty %s%s%s, protože závisí na sobě samé." #: lazarusidestrconsts:liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "Zrušit načítání této komponenty" #: lazarusidestrconsts:lisabortwholeloading msgid "Abort whole loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts:lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" msgstr "" #: lazarusidestrconsts:listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts:lismakeresourcestring msgid "Make ResourceString" msgstr "" #: lazarusidestrconsts:lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "" #: lazarusidestrconsts:lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "" #: lazarusidestrconsts:lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "" #: lazarusidestrconsts:lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "" #: lazarusidestrconsts:lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "Konstantní řetězec ve zdroji" #: lazarusidestrconsts:lismakeresstrconversionoptions msgid "Conversion Options" msgstr "" #: lazarusidestrconsts:lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "" #: lazarusidestrconsts:lismakeresstridentifierlength msgid "Identifier length:" msgstr "" #: lazarusidestrconsts:lismakeresstrdialogidentifier msgid "Identifier" msgstr "Identifikátor" #: lazarusidestrconsts:lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "" #: lazarusidestrconsts:lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "" #: lazarusidestrconsts:lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Řetězec se stejnou hodnotou:" #: lazarusidestrconsts:lismakeresstrappendtosection msgid "Append to section" msgstr "Doplnit k sekci" #: lazarusidestrconsts:lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "" #: lazarusidestrconsts:lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "" #: lazarusidestrconsts:lismakeresstrsourcepreview msgid "Source preview" msgstr "" #: lazarusidestrconsts:lisnostringconstantfound msgid "No string constant found" msgstr "" #: lazarusidestrconsts:lissuccess msgid "Success" msgstr "Úspěch" #: lazarusidestrconsts:lisallblockslooksok msgid "All blocks looks ok." msgstr "Všechny bloky vypadají dobře." #: lazarusidestrconsts:lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "" #: lazarusidestrconsts:lisdiffdlgtext1 msgid "Text1" msgstr "Text1" #: lazarusidestrconsts:lisdiffdlgonlyselection msgid "Only selection" msgstr "Pouze výběr" #: lazarusidestrconsts:lisdiffdlgtext2 msgid "Text2" msgstr "Text2" #: lazarusidestrconsts:lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "Nerozlišovat velikost znaků" #: lazarusidestrconsts:lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "" #: lazarusidestrconsts:lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "" #: lazarusidestrconsts:lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "" #: lazarusidestrconsts:lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "" #: lazarusidestrconsts:lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "Otevřít Diff v editoru" #: lazarusidestrconsts:lissave msgid "Save ..." msgstr "Uložit..." #: lazarusidestrconsts:listodolistcaption msgid "ToDo List" msgstr "Seznam úkolů" #: lazarusidestrconsts:listodolistrefresh msgid "Refresh todo items" msgstr "" #: lazarusidestrconsts:listodolistgotoline msgid "Goto selected source line" msgstr "" #: lazarusidestrconsts:listodolistprintlist msgid "Print todo items" msgstr "Tisk položek úkolovníku" #: lazarusidestrconsts:listodolistoptions msgid "ToDo options..." msgstr "Volby seznamu úkolů..." #: lazarusidestrconsts:lisctinsertmacro msgid "Insert Macro" msgstr "Vložit makro" #: lazarusidestrconsts:listodoldone msgid "Done" msgstr "Hotovo" #: lazarusidestrconsts:listodoldescription msgid "Description" msgstr "Popis" #: lazarusidestrconsts:listodolpriority msgid "Priority" msgstr "Priorita" #: lazarusidestrconsts:listodolfile msgid "Module" msgstr "Modul" #: lazarusidestrconsts:listodolline msgid "Line" msgstr "Řádek" #: lazarusidestrconsts:listodolowner msgid "Owner" msgstr "Vlastník" #: lazarusidestrconsts:listtodolcategory msgid "Category" msgstr "Skupina" #: lazarusidestrconsts:lispkgfiletypeunit msgid "Unit" msgstr "Jednotka" #: lazarusidestrconsts:lispkgfiletypevirtualunit msgid "Virtual Unit" msgstr "Virtuální jednotka" #: lazarusidestrconsts:lispkgfiletypelfm msgid "LFM - Lazarus form text" msgstr "" #: lazarusidestrconsts:lispkgfiletypelrs msgid "LRS - Lazarus resource" msgstr "" #: lazarusidestrconsts:lispkgfiletypeinclude msgid "Include file" msgstr "" #: lazarusidestrconsts:lispkgfiletypeissues msgid "Issues xml file" msgstr "" #: lazarusidestrconsts:lispkgfiletypetext msgid "Text" msgstr "Text" #: lazarusidestrconsts:lispkgfiletypebinary msgid "Binary" msgstr "Binární" #: lazarusidestrconsts:lisviewprojectunits msgid "View Project Units" msgstr "Zobrazit jednotky projektu" #: lazarusidestrconsts:lisinformationaboutunit msgid "Information about %s" msgstr "Informace o %s" #: lazarusidestrconsts:lisuidyes msgid "yes" msgstr "ano" #: lazarusidestrconsts:lisuidno msgid "no" msgstr "ne" #: lazarusidestrconsts:lisuidbytes msgid "%s bytes" msgstr "%s bajtů" #: lazarusidestrconsts:lisuidname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts:lisuidtype msgid "Type:" msgstr "Typ:" #: lazarusidestrconsts:lisuidinproject msgid "in Project:" msgstr "v projektu:" #: lazarusidestrconsts:lisuidincludedby msgid "Included by:" msgstr "" #: lazarusidestrconsts:lisuidclear msgid "Clear" msgstr "Smazat" #: lazarusidestrconsts:lisuidpathsreadonly msgid "Paths (Read Only)" msgstr "Cesty (pouze ke čtení)" #: lazarusidestrconsts:lisuidunit msgid "Unit" msgstr "Jednotka" #: lazarusidestrconsts:lisuidsrc msgid "Src" msgstr "Zdroj" #: lazarusidestrconsts:lisuidok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts:lisuidsize msgid "Size:" msgstr "Velikost:" #: lazarusidestrconsts:lisuidlines msgid "Lines:" msgstr "Řádky:" #: lazarusidestrconsts:lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "" #: lazarusidestrconsts:lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Chyba v regulárním výrazu" #: lazarusidestrconsts:lissearchfor msgid "Search For " msgstr "" #: lazarusidestrconsts:lisuenotfound msgid "Not found" msgstr "Nenalezeno" #: lazarusidestrconsts:lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "" #: lazarusidestrconsts:lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgstr "" #: lazarusidestrconsts:lisuesearching msgid "Searching: %s" msgstr "Hledání: %s" #: lazarusidestrconsts:lisuereadonly msgid "%s/ReadOnly" msgstr "%s/Pouze pro čtení" #: lazarusidestrconsts:lisuegotoline msgid "Goto line :" msgstr "" #: lazarusidestrconsts:listmfunctionextractfileextension msgid "Function: extract file extension" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilepath msgid "Function: extract file path" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilenameextension msgid "Function: extract file name+extension" msgstr "" #: lazarusidestrconsts:listmfunctionextractfilenameonly msgid "Function: extract file name only" msgstr "" #: lazarusidestrconsts:listmfunctionappendpathdelimiter msgid "Function: append path delimiter" msgstr "" #: lazarusidestrconsts:listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" msgstr "" #: lazarusidestrconsts:listmunknownmacro msgid "(unknown macro: %s)" msgstr "(neznámé makro: %s)" #: lazarusidestrconsts:lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "" #: lazarusidestrconsts:lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." msgstr "%s%s%s není platný identifikátor." #: lazarusidestrconsts:lisfriidentifier msgid "Identifier: %s" msgstr "" #: lazarusidestrconsts:lissvuooverridesystemvariable msgid "Override system variable" msgstr "" #: lazarusidestrconsts:lissvuook msgid "Ok" msgstr "Ok" #: lazarusidestrconsts:lissortselsortselection msgid "Sort selection" msgstr "Seřadit výběr" #: lazarusidestrconsts:lissortselpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts:lissortselascending msgid "Ascending" msgstr "Vzestupný" #: lazarusidestrconsts:lissortseldescending msgid "Descending" msgstr "Sestupný" #: lazarusidestrconsts:lissortseldomain msgid "Domain" msgstr "Doména" #: lazarusidestrconsts:lissortsellines msgid "Lines" msgstr "Řádky" #: lazarusidestrconsts:lissortselwords msgid "Words" msgstr "Slova" #: lazarusidestrconsts:lissortselparagraphs msgid "Paragraphs" msgstr "Odstavce" #: lazarusidestrconsts:lissortseloptions msgid "Options" msgstr "Nastavení" #: lazarusidestrconsts:lissortselcasesensitive msgid "&Case Sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts:lissortselignorespace msgid "Ignore Space" msgstr "Ignorovat mezery" #: lazarusidestrconsts:lissortselsort msgid "Accept" msgstr "Přijmout" #: lazarusidestrconsts:lissortselcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts:lispublprojinvalidincludefilter msgid "Invalid Include filter" msgstr "" #: lazarusidestrconsts:lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" msgstr "" #: lazarusidestrconsts:lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "" #: lazarusidestrconsts:lisprojoptserror msgid "Error" msgstr "Chyba" #: lazarusidestrconsts:lispatheditselectdirectory msgid "Select directory" msgstr "" #: lazarusidestrconsts:lispatheditsearchpaths msgid "Search paths:" msgstr "" #: lazarusidestrconsts:lispatheditmovepathdown msgid "Move path down" msgstr "" #: lazarusidestrconsts:lispatheditmovepathup msgid "Move path up" msgstr "" #: lazarusidestrconsts:lispatheditbrowse msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts:lispatheditpathtemplates msgid "Path templates" msgstr "Šablony cest" #: lazarusidestrconsts:lisnewdlgnoitemselected msgid "No item selected" msgstr "" #: lazarusidestrconsts:liserroropeningcomponent msgid "Error opening component" msgstr "Chyba otevírání komponenty" #: lazarusidestrconsts:lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "" #: lazarusidestrconsts:lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." msgstr "Vytvořit nový editovaný soubor.%sVyberte typ." #: lazarusidestrconsts:lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "" #: lazarusidestrconsts:lisinheriteditem msgid "Inherited Item" msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "" #: lazarusidestrconsts:lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "" #: lazarusidestrconsts:lispackage msgid "Package" msgstr "Balíček" #: lazarusidestrconsts:lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Vytvořit novou pascalovskou jednotku." #: lazarusidestrconsts:lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame" msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Vytvořit prázdný textový soubor." #: lazarusidestrconsts:lisnewdlginheritanexistingcomponent msgid "Inherit from an existing component." msgstr "" #: lazarusidestrconsts:lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." msgstr "Soubor jednoduchého pascalovkého programu.%sLze jej použit pro rychlé a špinavé testování.%sLepší je vytvořit nový projekt." #: lazarusidestrconsts:lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou grafickou aplikaci.%sSoubor programu je spravován Lazarusem." #: lazarusidestrconsts:lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." msgstr "" #: lazarusidestrconsts:lisnewdlgcreateanewcustomprogram msgid "Create a new program." msgstr "Vytvořit nový program." #: lazarusidestrconsts:lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou cgi aplikaci.%sProgramový soubor je spravován Lazarusem." #: lazarusidestrconsts:lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "" #: lazarusidestrconsts:lisunabletocreatefile msgid "Unable to create file" msgstr "" #: lazarusidestrconsts:liscannotcreatefile msgid "Can not create file %s%s%s" msgstr "Nelze vytvořit soubor %s%s%s" #: lazarusidestrconsts:lisextendunitpath msgid "Extend unit path?" msgstr "" #: lazarusidestrconsts:listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgstr "" #: lazarusidestrconsts:lisunabletocreatefilename msgid "Unable to create file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletowritefile msgid "Unable to write file" msgstr "" #: lazarusidestrconsts:lisunabletowritefile2 msgid "Unable to write file %s%s%s" msgstr "" #: lazarusidestrconsts:lisfileisnotwritable msgid "File is not writable" msgstr "Soubor není zapisovatelný" #: lazarusidestrconsts:lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletowritefilename msgid "Unable to write file %s%s%s." msgstr "" #: lazarusidestrconsts:lisunabletoreadfile msgid "Unable to read file" msgstr "Nelze přečíst soubor" #: lazarusidestrconsts:lisunabletoreadfilename msgid "Unable to read file %s%s%s." msgstr "" #: lazarusidestrconsts:liserrordeletingfile msgid "Error deleting file" msgstr "Chyba mazání souboru" #: lazarusidestrconsts:lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" msgstr "" #: lazarusidestrconsts:liserrorrenamingfile msgid "Error renaming file" msgstr "Chyba přejmenování souboru" #: lazarusidestrconsts:lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgstr "" #: lazarusidestrconsts:liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgstr "Varování: nejednoznačný soubor nalezen: %s%s%s. Zdrojový soubor je: %s%s%" #: lazarusidestrconsts:lisambiguousfilefound msgid "Ambiguous file found" msgstr "Nalezen nejasný soubor" #: lazarusidestrconsts:listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts:lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "" #: lazarusidestrconsts:lisprojaddthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts:lisprojaddinvalidpackagename msgid "Invalid packagename" msgstr "" #: lazarusidestrconsts:lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgstr "" #: lazarusidestrconsts:lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Závislost již existuje" #: lazarusidestrconsts:lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddpackagenotfound msgid "Package not found" msgstr "" #: lazarusidestrconsts:lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "" #: lazarusidestrconsts:lisldnovalidlazdocpath msgid "No valid LazDoc path" msgstr "" #: lazarusidestrconsts:lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s" msgstr "%s nemá žádnou platnou LazDoc cestu.%sNelze vytvořit soubor fpdoc pro %s" #: lazarusidestrconsts:liserrorreadingxml msgid "Error reading XML" msgstr "Chyba načítání XML" #: lazarusidestrconsts:liserrorreadingxmlfile msgid "Error reading xml file %s%s%s%s%s" msgstr "Chyba čtení xml souboru %s%s%s%s" #: lazarusidestrconsts:lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "" #: lazarusidestrconsts:lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisprojaddinvalidversion msgid "Invalid version" msgstr "" #: lazarusidestrconsts:lisprojaddtheminimumversionisinvalid msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" msgstr "" #: lazarusidestrconsts:lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Jméno jednotky již existuje" #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts:lisprojaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts:lisprojaddnewrequirement msgid "New Requirement" msgstr "Nové požadavky" #: lazarusidestrconsts:lisprojaddfiles msgid "Add files" msgstr "Přidat soubory" #: lazarusidestrconsts:lisprojaddeditorfile msgid "Add editor files" msgstr "Přidat editované soubory" #: lazarusidestrconsts:lisprojaddaddfiletoproject msgid "Add file to project:" msgstr "Přidat soubor do projektu:" #: lazarusidestrconsts:lisprojaddpackagename msgid "Package Name:" msgstr "" #: lazarusidestrconsts:lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Minimální verze (nepovinné):" #: lazarusidestrconsts:lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "Maximální verze (nepovinné):" #: lazarusidestrconsts:liskmnewpackage msgid "New package" msgstr "Nový balíček" #: lazarusidestrconsts:liscomppalopenpackage msgid "Open package" msgstr "Otevřít balíček" #: lazarusidestrconsts:liskmopenpackagefile msgid "Open package file" msgstr "Otevřít soubor balíčku" #: lazarusidestrconsts:liscpopenpackage msgid "Open Package %s" msgstr "Otevřít balíček %s" #: lazarusidestrconsts:liscpopenunit msgid "Open Unit %s" msgstr "Otevřít jednotku %s" #: lazarusidestrconsts:liscomppalopenunit msgid "Open unit" msgstr "Otevřít jednotku" #: lazarusidestrconsts:liscomppalfindcomponent msgid "Find component" msgstr "Najít komponentu" #: lazarusidestrconsts:lismacropromptenterdata msgid "Enter data" msgstr "Zadejte údaje" #: lazarusidestrconsts:lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Zadejte spouštěcí parametry" #: lazarusidestrconsts:lisdebuggererror msgid "Debugger error" msgstr "Chyba ladiče" #: lazarusidestrconsts:lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgstr "" #: lazarusidestrconsts:lisexecutionstopped msgid "Execution stopped" msgstr "" #: lazarusidestrconsts:lisexecutionstoppedon msgid "Execution stopped%s" msgstr "" #: lazarusidestrconsts:lisexecutionpaused msgid "Execution paused" msgstr "" #: lazarusidestrconsts:lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" msgstr "" #: lazarusidestrconsts:lisfilenotfound msgid "File not found" msgstr "Soubor nenalezen" #: lazarusidestrconsts:liscleanupunitpath msgid "Clean up unit path?" msgstr "Vyčistit cestu jednotky?" #: lazarusidestrconsts:listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgstr "" #: lazarusidestrconsts:listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgstr "" #: lazarusidestrconsts:lisruntofailed msgid "Run-to failed" msgstr "Spustit-po selhalo" #: lazarusidestrconsts:lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "Nebyl učený ladící nástroj" #: lazarusidestrconsts:lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgstr "" #: lazarusidestrconsts:lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "" #: lazarusidestrconsts:lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "" #: lazarusidestrconsts:listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts:listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." msgstr "" #: lazarusidestrconsts:lisdebuggerinvalid msgid "Debugger invalid" msgstr "" #: lazarusidestrconsts:listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" msgstr "" #: lazarusidestrconsts:lisunabletorun msgid "Unable to run" msgstr "Nelze spustit" #: lazarusidestrconsts:listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." msgstr "" #: lazarusidestrconsts:listheworkingdirectorydoesnotexistpleasechecktheworki msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "" #: lazarusidestrconsts:lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "" #: lazarusidestrconsts:lisdiskdifferrorreadingfile msgid "Error reading file: %s" msgstr "Chyba načítání souboru: %s" #: lazarusidestrconsts:lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "" #: lazarusidestrconsts:lisdiskdiffchangedfiles msgid "Changed files:" msgstr "Změněné soubory:..." #: lazarusidestrconsts:lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Ke zobrazení rozdílu klikněte na jednu z položek nahoře" #: lazarusidestrconsts:lisdiskdiffrevertall msgid "Reload from disk" msgstr "Znovu načíst z disku" #: lazarusidestrconsts:lisdiskdiffignorediskchanges msgid "Ignore disk changes" msgstr "" #: lazarusidestrconsts:lisedtdefcurrentproject msgid "Current Project" msgstr "" #: lazarusidestrconsts:lisedtdefcurrentprojectdirectory msgid "Current Project Directory" msgstr "" #: lazarusidestrconsts:lisedtdefprojectsrcpath msgid "Project SrcPath" msgstr "" #: lazarusidestrconsts:lisedtdefprojectincpath msgid "Project IncPath" msgstr "" #: lazarusidestrconsts:lisedtdefprojectunitpath msgid "Project UnitPath" msgstr "" #: lazarusidestrconsts:lisedtdefallpackages msgid "All packages" msgstr "Všechny balíčky" #: lazarusidestrconsts:lisedtdefsallprojects msgid "All projects" msgstr "Všechny projekty" #: lazarusidestrconsts:lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetomacpas msgid "set FPC mode to MacPas" msgstr "" #: lazarusidestrconsts:lisedtdefsetfpcmodetofpc msgid "set FPC mode to FPC" msgstr "" #: lazarusidestrconsts:lisedtdefsetiocheckson msgid "set IOCHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefsetrangecheckson msgid "set RANGECHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" msgstr "" #: lazarusidestrconsts:lisedtdefuselineinfounit msgid "use LineInfo unit" msgstr "použít jednotku LineInfo" #: lazarusidestrconsts:lisedtdefuseheaptrcunit msgid "use HeapTrc unit" msgstr "použít jednotku HeapTrc" #: lazarusidestrconsts:lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" msgstr "" #: lazarusidestrconsts:lisexttoolfailedtoruntool msgid "Failed to run tool" msgstr "Nelze spustit nástroj" #: lazarusidestrconsts:lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" msgstr "" #: lazarusidestrconsts:lisexttoolexternaltools msgid "External tools" msgstr "" #: lazarusidestrconsts:lisexttoolremove msgid "Remove" msgstr "Odstranit" #: lazarusidestrconsts:liskeepthemandcontinue msgid "Keep them and continue" msgstr "Ponechat je a pokračovat" #: lazarusidestrconsts:lisremovethem msgid "Remove them" msgstr "Odstranit je" #: lazarusidestrconsts:lisexttoolmoveup msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts:lisexttoolmovedown msgid "Down" msgstr "Dolů" #: lazarusidestrconsts:lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "" #: lazarusidestrconsts:lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Toto je maximální počet nástrojů %s." #: lazarusidestrconsts:lisexttooltitlecompleted msgid "\"%s\" completed" msgstr "\"%s\" hotovo" #: lazarusidestrconsts:lisedtexttooledittool msgid "Edit Tool" msgstr "Nástroj pro úpravy" #: lazarusidestrconsts:lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Jméno souboru programu:" #: lazarusidestrconsts:lisedtexttoolparameters msgid "Parameters:" msgstr "Parametry:" #: lazarusidestrconsts:lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Pracovní složka:" #: lazarusidestrconsts:lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" msgstr "" #: lazarusidestrconsts:lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" msgstr "" #: lazarusidestrconsts:lisedtexttoolkey msgid "Key" msgstr "Klávesa" #: lazarusidestrconsts:lisalternativekey msgid "Alternative key" msgstr "Alternativní klávesa" #: lazarusidestrconsts:lisedtexttoolctrl msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts:lisedtexttoolalt msgid "Alt" msgstr "Alt" #: lazarusidestrconsts:lisedtexttoolshift msgid "Shift" msgstr "Shift" #: lazarusidestrconsts:lisedtexttoolmacros msgid "Macros" msgstr "Makra" #: lazarusidestrconsts:lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "Pracovní složka pro sestavení" #: lazarusidestrconsts:lisworkingdirectoryforrun msgid "Working directory for run" msgstr "Pracovní složka pro spuštění" #: lazarusidestrconsts:lisconfigurebuild msgid "Configure Build %s" msgstr "Nastavit sestavení %s" #: lazarusidestrconsts:lisedtexttoolinsert msgid "Insert" msgstr "Vložit" #: lazarusidestrconsts:lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Požadováno název a jméno souboru" #: lazarusidestrconsts:lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru." #: lazarusidestrconsts:lisfindfiletexttofind msgid "Text to find:" msgstr "Text k nalezení:" #: lazarusidestrconsts:lisfindfilecasesensitive msgid "&Case sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts:lisfindfilewholewordsonly msgid "&Whole words only" msgstr "&Pouze celková slova" #: lazarusidestrconsts:lisfindfileregularexpressions msgid "&Regular expressions" msgstr "&Regulární výrazy" #: lazarusidestrconsts:lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "&Víceřádkový vzor" #: lazarusidestrconsts:lisfindfilewhere msgid "Where" msgstr "Kde" #: lazarusidestrconsts:lisfindfilesearchallfilesinproject msgid "search all files in &project" msgstr "" #: lazarusidestrconsts:lisfindfilesearchallopenfiles msgid "search all &open files" msgstr "" #: lazarusidestrconsts:lisfindfilesearchindirectories msgid "search in &directories" msgstr "" #: lazarusidestrconsts:lisfindfiledirectoryoptions msgid "Directory options" msgstr "Nastavení složky" #: lazarusidestrconsts:lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" msgstr "Maska souboru (*;*.*;*.bak?)" #: lazarusidestrconsts:lisfindfileincludesubdirectories msgid "Include sub directories" msgstr "" #: lazarusidestrconsts:lisfindfileonlytextfiles msgid "Only text files" msgstr "Pouze textové soubory" #: lazarusidestrconsts:lispkgmangpackage msgid "Package: %s" msgstr "Balík: %s" #: lazarusidestrconsts:lispkgmangproject msgid "Project: %s" msgstr "Projekt: %s" #: lazarusidestrconsts:lispkgmanglazarus msgid "Lazarus" msgstr "Lazarus" #: lazarusidestrconsts:lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Závislost bez vlastníka: %s" #: lazarusidestrconsts:lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "Neplatná přípona balíčku" #: lazarusidestrconsts:lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts:lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "" #: lazarusidestrconsts:lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts:lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "Měl by být soubor přejmenován na malé znaky na %s%s%s%s?" #: lazarusidestrconsts:lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "" #: lazarusidestrconsts:lisnameconflict msgid "Name conflict" msgstr "Konflikt jmen" #: lazarusidestrconsts:listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "" #: lazarusidestrconsts:lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "Jméno souboru je použito projektem" #: lazarusidestrconsts:lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgstr "" #: lazarusidestrconsts:lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "Jméno souboru je použito jiným balíčkem" #: lazarusidestrconsts:lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgstr "" #: lazarusidestrconsts:lispkgmangreplacefile msgid "Replace File" msgstr "Nahradit soubor" #: lazarusidestrconsts:lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "Nahradit existující soubor %s%s%s?" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Smazat starý soubor balíčku?" #: lazarusidestrconsts:lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" msgstr "Odstranit starý soubor balíčku %s%s%s?" #: lazarusidestrconsts:lispkgmangdeletefailed msgid "Delete failed" msgstr "Odstranění selhalo" #: lazarusidestrconsts:lisambiguousunitfound msgid "Ambiguous Unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts:listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit.Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." msgstr "Nelze smazat soubor %s%s%s." #: lazarusidestrconsts:lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Odstranit všechny tyto soubory?" #: lazarusidestrconsts:lispkgmangunsavedpackage msgid "Unsaved package" msgstr "Neuložený balíček" #: lazarusidestrconsts:lisfpcmakefailed msgid "fpcmake failed" msgstr "" #: lazarusidestrconsts:liscallingtocreatemakefilefromfailed msgid "Calling %s to create Makefile from %s failed." msgstr "Volání %s k vytvoření Makefile z %s selhalo." #: lazarusidestrconsts:lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "" #: lazarusidestrconsts:lispkgmangbrokendependency msgid "Broken dependency" msgstr "Porušená závislost" #: lazarusidestrconsts:lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgstr "" #: lazarusidestrconsts:lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." msgstr "Požadovaný balíkček nenalezen. Podívejte se na graf balíčků." #: lazarusidestrconsts:lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" msgstr "Kruh v závislostech balíčků" #: lazarusidestrconsts:lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "" #: lazarusidestrconsts:lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Nejednoznačné jednotky nalezeny" #: lazarusidestrconsts:lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem." #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangerrorwritingfile msgid "Error writing file" msgstr "Cyba zapisování souboru" #: lazarusidestrconsts:lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangerrorreadingfile msgid "Error reading file" msgstr "Chyba načítání souboru" #: lazarusidestrconsts:lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatedirectory msgid "Unable to create directory" msgstr "" #: lazarusidestrconsts:lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "" #: lazarusidestrconsts:lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts:lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "Nelze načíst balíček" #: lazarusidestrconsts:lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgstr "Nelze otevřít balíček %s%s%s.%sTento balíček byl označen k instalaci." #: lazarusidestrconsts:lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts:lisopenpackage2 msgid "Open package %s" msgstr "" #: lazarusidestrconsts:lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgstr "" #: lazarusidestrconsts:lispkgmangpackageconflicts msgid "Package conflicts" msgstr "" #: lazarusidestrconsts:lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." msgstr "" #: lazarusidestrconsts:lispkgmangsavepackage msgid "Save Package?" msgstr "" #: lazarusidestrconsts:lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgstr "" #: lazarusidestrconsts:lispkgmangnewpackage msgid "NewPackage" msgstr "Nový balíček" #: lazarusidestrconsts:lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" msgstr "" #: lazarusidestrconsts:lispackageneedsinstallation msgid "Package needs installation" msgstr "" #: lazarusidestrconsts:lisunitinpackage msgid "%s unit %s in package %s%s" msgstr "%s jednotka %s v balíčku %s%s" #: lazarusidestrconsts:lispkgmangskipthispackage msgid "Skip this package" msgstr "Přeskočit tento balíček" #: lazarusidestrconsts:lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "" #: lazarusidestrconsts:lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." msgstr "" #: lazarusidestrconsts:lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "Neplatné jméno souboru balíčku" #: lazarusidestrconsts:lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." msgstr "" #: lazarusidestrconsts:lispkgmangfilenotfound msgid "File %s%s%s not found." msgstr "Soubor %s%s%s nenalezen." #: lazarusidestrconsts:lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "Chyba načítání balíčku" #: lazarusidestrconsts:lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts:lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "Jméno souboru se liší od jména balíčku" #: lazarusidestrconsts:lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgstr "" #: lazarusidestrconsts:lispkgmangsavepackage2 msgid "Save package?" msgstr "" #: lazarusidestrconsts:lispkgmangpackagefilemissing msgid "Package file missing" msgstr "" #: lazarusidestrconsts:lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." msgstr "" #: lazarusidestrconsts:lispkgmangpackagefilenotsaved msgid "Package file not saved" msgstr "" #: lazarusidestrconsts:lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." msgstr "" #: lazarusidestrconsts:lispkgmangignoreandsavepackagenow msgid "Ignore and save package now" msgstr "" #: lazarusidestrconsts:lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "" #: lazarusidestrconsts:lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "Chyba zapisování balíčku" #: lazarusidestrconsts:lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts:lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" msgstr "%sPodívejte se na Projekt -> Inspektor projektu" #: lazarusidestrconsts:lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "" #: lazarusidestrconsts:lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "" #: lazarusidestrconsts:lismissingpackages msgid "Missing Packages" msgstr "Chybějící balíčky" #: lazarusidestrconsts:lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" msgstr "" #: lazarusidestrconsts:lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" msgstr "" #: lazarusidestrconsts:lispkgmangpackagemainsourcefile msgid "package main source file" msgstr "" #: lazarusidestrconsts:lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" msgstr "" #: lazarusidestrconsts:lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." msgstr "" #: lazarusidestrconsts:lispkgmangrenamefileinpackage msgid "Rename file in package?" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" msgstr "" #: lazarusidestrconsts:liserrorloadingfile msgid "Error loading file" msgstr "Chyba načítání souboru" #: lazarusidestrconsts:lisloadingfailed msgid "Loading %s failed." msgstr "" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s%s" #: lazarusidestrconsts:lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s%s" #: lazarusidestrconsts:lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgstr "%sNásledující jednotky budou přidány do sekce uses jednotky %s%s:%s%s%s" #: lazarusidestrconsts:lisconfirmchanges msgid "Confirm changes" msgstr "Potvrdit změny" #: lazarusidestrconsts:lispkgmangfilenotsaved msgid "File not saved" msgstr "Soubor není uložený" #: lazarusidestrconsts:lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "" #: lazarusidestrconsts:lispkgmangfileisinproject msgid "File is in Project" msgstr "Soubor je projekt" #: lazarusidestrconsts:lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Varování: Soubor %s%s%s%spatří k aktuálnímu projektu." #: lazarusidestrconsts:lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "Soubor je již obsažen v balíčku" #: lazarusidestrconsts:lispkgmangthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts:lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgstr "" #: lazarusidestrconsts:lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Automaticky instalované balíčky" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" msgstr "" #: lazarusidestrconsts:lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" msgstr "" #: lazarusidestrconsts:lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Přestavět Lazarus?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts:lispkgmangpackageisrequired msgid "Package is required" msgstr "" #: lazarusidestrconsts:lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgstr "" #: lazarusidestrconsts:lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Odinstalovat balíček?" #: lazarusidestrconsts:lispkgmanguninstallpackage2 msgid "Uninstall package %s?" msgstr "Odinstalovat balíček %s?" #: lazarusidestrconsts:lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts:lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" #: lazarusidestrconsts:lispkgmangpleasesavethepackagefirst msgid "Please save the package first." msgstr "" #: lazarusidestrconsts:lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" msgstr "" #: lazarusidestrconsts:lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "" #: lazarusidestrconsts:lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." msgstr "" #: lazarusidestrconsts:lispkgsysinvalidunitname msgid "Invalid Unitname: %s" msgstr "" #: lazarusidestrconsts:lispkgsysunitnotfound msgid "Unit not found: %s%s%s" msgstr "Jednotka nenalezena: %s%s%s" #: lazarusidestrconsts:lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" msgstr "Jednotka %s%s%s byla odebrána z balíčku" #: lazarusidestrconsts:lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" msgstr "Nelze registrovat komponenty bez jednotky" #: lazarusidestrconsts:lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "" #: lazarusidestrconsts:lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" msgstr "Třída komponenty %s%s%s je již definována." #: lazarusidestrconsts:lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." msgstr "" #: lazarusidestrconsts:lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sJméno jednotky: %s%s%s" #: lazarusidestrconsts:lispkgsysfilename msgid "%s%sFile Name: %s%s%s" msgstr "%s%sJméno souboru: %s%s%s" #: lazarusidestrconsts:lispkgsysregistrationerror msgid "Registration Error" msgstr "" #: lazarusidestrconsts:lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." msgstr "" #: lazarusidestrconsts:lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." msgstr "" #: lazarusidestrconsts:lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." msgstr "" #: lazarusidestrconsts:lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" msgstr "" #: lazarusidestrconsts:lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" msgstr "" #: lazarusidestrconsts:lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." msgstr "" #: lazarusidestrconsts:lispkgsysregisterprocedureisnil msgid "Register procedure is nil" msgstr "" #: lazarusidestrconsts:lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." msgstr "" #: lazarusidestrconsts:lispkgsyspackagefilenotfound msgid "Package file not found" msgstr "" #: lazarusidestrconsts:lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgstr "" #: lazarusidestrconsts:lispkgdefsoutputdirectory msgid "Output directory" msgstr "Výstupní adresář" #: lazarusidestrconsts:lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" msgstr "" #: lazarusidestrconsts:lispkgdefsunitpath msgid "Unit Path" msgstr "Cesta jednotky" #: lazarusidestrconsts:lisprojprojectsourcedirectorymark msgid "Project Source Directory Mark" msgstr "" #: lazarusidestrconsts:lispkgdefssrcdirmark msgid "Package Source Directory Mark" msgstr "" #: lazarusidestrconsts:lisaf2pinvalidpackage msgid "Invalid Package" msgstr "Neplatný balíček" #: lazarusidestrconsts:lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" msgstr "Neplatné ID balíčku: %s%s%s" #: lazarusidestrconsts:lisaf2ppackagenotfound msgid "Package %s%s%s not found." msgstr "" #: lazarusidestrconsts:lisaf2ppackageisreadonly msgid "Package is read only" msgstr "" #: lazarusidestrconsts:lisaf2pthepackageisreadonly msgid "The package %s is read only." msgstr "" #: lazarusidestrconsts:lisaf2pthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts:lisaf2punitname msgid "Unit Name: " msgstr "Jméno jednotky:" #: lazarusidestrconsts:lisaf2phasregisterprocedure msgid "Has Register procedure" msgstr "" #: lazarusidestrconsts:lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" msgstr "Virtuální jednotka (zdrojové soubory nejsou v balíčku)" #: lazarusidestrconsts:lisaf2pfiletype msgid "File Type" msgstr "Typ souboru" #: lazarusidestrconsts:lisaf2pdestinationpackage msgid "Destination Package" msgstr "Cílový balíček" #: lazarusidestrconsts:lisaf2pshowall msgid "Show All" msgstr "Ukázat vše" #: lazarusidestrconsts:lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Přidat soubor do balíčku" #: lazarusidestrconsts:lisa2pinvalidfilename msgid "Invalid filename" msgstr "" #: lazarusidestrconsts:lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts:lisa2pfilenotunit msgid "File not unit" msgstr "Soubor není jednotka" #: lazarusidestrconsts:lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" msgstr "" #: lazarusidestrconsts:lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." msgstr "%s%s%s není platné jméno jednotky." #: lazarusidestrconsts:lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Jméno jednotky už existuje" #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." msgstr "" #: lazarusidestrconsts:lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" msgstr "" #: lazarusidestrconsts:lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Nejednoznačné jméno jednotky" #: lazarusidestrconsts:lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." msgstr "" #: lazarusidestrconsts:lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." msgstr "Soubor %s%s%s již existuje v projektu" #: lazarusidestrconsts:lisa2pexistingfile msgid "%sExisting file: %s%s%s" msgstr "%sExistující soubor: %s%s%s" #: lazarusidestrconsts:lisa2pfilealreadyexists msgid "File already exists" msgstr "Soubor již existuje" #: lazarusidestrconsts:lisa2pfileisused msgid "File is used" msgstr "Soubor je použit" #: lazarusidestrconsts:lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "" #: lazarusidestrconsts:lisa2pthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts:lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts:lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "" #: lazarusidestrconsts:lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgstr "" #: lazarusidestrconsts:lisa2pfilealreadyinpackage msgid "File already in package" msgstr "Soubor je již obsažen v balíčku" #: lazarusidestrconsts:lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." msgstr "Soubor %s%s%s už je v balíčku." #: lazarusidestrconsts:lisa2pinvalidfile msgid "Invalid file" msgstr "" #: lazarusidestrconsts:lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts:lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "" #: lazarusidestrconsts:lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisa2ppagenametoolong msgid "Page Name too long" msgstr "Jméno stránky je příliš dlouhé" #: lazarusidestrconsts:lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." msgstr "" #: lazarusidestrconsts:lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "Neplatné jméno jednotky" #: lazarusidestrconsts:lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." msgstr "" #: lazarusidestrconsts:lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "" #: lazarusidestrconsts:lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts:lisa2pinvalidcircle msgid "Invalid Circle" msgstr "" #: lazarusidestrconsts:lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgstr "" #: lazarusidestrconsts:lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "Nejednoznačný typ předka" #: lazarusidestrconsts:lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Nejednoznačné jméno třídy" #: lazarusidestrconsts:lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts:lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "Jméno třídy již existuje" #: lazarusidestrconsts:lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts:lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts:lisa2paddunit msgid "Add Unit" msgstr "Přidat jednotku" #: lazarusidestrconsts:lisa2pnewfile msgid "New File" msgstr "Nový soubor" #: lazarusidestrconsts:lisa2pnewcomponent msgid "New Component" msgstr "Nová komponenta" #: lazarusidestrconsts:lisa2paddfile msgid "Add File" msgstr "Přidat soubor" #: lazarusidestrconsts:lisa2paddfiles msgid "Add Files" msgstr "Přidat soubory" #: lazarusidestrconsts:lisa2punitfilename msgid "Unit file name:" msgstr "Jméno souboru jednotky:" #: lazarusidestrconsts:lisa2pchooseanexistingfile msgid "" msgstr "" #: lazarusidestrconsts:lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" msgstr "Přidat soubory LFM a LRS pokud existují." #: lazarusidestrconsts:lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" msgstr "" #: lazarusidestrconsts:lisa2pancestortype msgid "Ancestor Type" msgstr "Typ předka" #: lazarusidestrconsts:lisa2pshowall msgid "Show all" msgstr "Ukázat vše" #: lazarusidestrconsts:lisa2pnewclassname msgid "New class name:" msgstr "Nové jméno třídy:" #: lazarusidestrconsts:lisa2ppalettepage msgid "Palette Page:" msgstr "Stránka sady:" #: lazarusidestrconsts:lisa2punitfilename2 msgid "Unit File Name:" msgstr "Jméno souboru jednotky:" #: lazarusidestrconsts:lisa2punitname msgid "Unit Name:" msgstr "Jméno jednotky:" #: lazarusidestrconsts:lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Zkrátit nebo rozšířit jméno souboru" #: lazarusidestrconsts:lisa2psavefiledialog msgid "Save file dialog" msgstr "" #: lazarusidestrconsts:lisa2pfilename msgid "File name:" msgstr "Jméno souboru:" #: lazarusidestrconsts:lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Změna jména nebo verze balíčku naruší závislosti. Měly by být změněny také tyto závislosti?%sVyberte Ano ke změně všech uvedených závislostí.%sVyberte Ignorovat k porušení závislostí a pokračování." #: lazarusidestrconsts:lisa2pdependency msgid "Dependency" msgstr "Závislost" #: lazarusidestrconsts:lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Porušená závislost" #: lazarusidestrconsts:lisoipfilename msgid "Filename: %s" msgstr "Jméno souboru: %s" #: lazarusidestrconsts:lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" msgstr "%sTento balíček byl vytvořen automaticky" #: lazarusidestrconsts:lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen" #: lazarusidestrconsts:lisoipdescriptiondescription msgid "%sDescription: %s" msgstr "%sPopis: %s" #: lazarusidestrconsts:lisoipdescription msgid "Description: " msgstr "Popis: " #: lazarusidestrconsts:lisoippleaseselectapackage msgid "Please select a package" msgstr "" #: lazarusidestrconsts:lisoipnopackageselected msgid "No package selected" msgstr "" #: lazarusidestrconsts:lisoippleaseselectapackagetoopen msgid "Please select a package to open" msgstr "" #: lazarusidestrconsts:lisoippackagename msgid "Package Name" msgstr "Jméno balíčku" #: lazarusidestrconsts:lisoipstate msgid "State" msgstr "Stav" #: lazarusidestrconsts:lisoipmodified msgid "modified" msgstr "změněný" #: lazarusidestrconsts:lisoipmissing msgid "missing" msgstr "chybějící" #: lazarusidestrconsts:lisoipinstalledstatic msgid "installed static" msgstr "" #: lazarusidestrconsts:lisoipinstalleddynamic msgid "installed dynamic" msgstr "" #: lazarusidestrconsts:lisoipautoinstallstatic msgid "auto install static" msgstr "automaticky instaluj statické" #: lazarusidestrconsts:lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "automaticky instaluj dynamické" #: lazarusidestrconsts:lisoipreadonly msgid "readonly" msgstr "" #: lazarusidestrconsts:lisoipopenloadedpackage msgid "Open loaded package" msgstr "" #: lazarusidestrconsts:lispckeditremovefile msgid "Remove file" msgstr "Odstranit soubor" #: lazarusidestrconsts:lispemovefileup msgid "Move file up" msgstr "" #: lazarusidestrconsts:lispemovefiledown msgid "Move file down" msgstr "" #: lazarusidestrconsts:lispckeditreaddfile msgid "Re-Add file" msgstr "" #: lazarusidestrconsts:lispesortfiles msgid "Sort files" msgstr "Řadit soubory" #: lazarusidestrconsts:lispefixfilescase msgid "Fix Files Case" msgstr "" #: lazarusidestrconsts:lispckeditremovedependency msgid "Remove dependency" msgstr "Odstranit závislost" #: lazarusidestrconsts:lispckeditmovedependencyup msgid "Move dependency up" msgstr "" #: lazarusidestrconsts:lispckeditmovedependencydown msgid "Move dependency down" msgstr "" #: lazarusidestrconsts:lispckeditreadddependency msgid "Re-Add dependency" msgstr "" #: lazarusidestrconsts:lispckeditsetdependencydefaultfilename msgid "Store dependency filename" msgstr "Uložit jméno souboru závislosti" #: lazarusidestrconsts:lispckeditcleardependencydefaultfilename msgid "Clear dependency filename" msgstr "Smazat jméno závislého souboru" #: lazarusidestrconsts:lispckeditcompile msgid "Compile" msgstr "Přeložit" #: lazarusidestrconsts:lispckeditrecompileclean msgid "Recompile clean" msgstr "" #: lazarusidestrconsts:lispckeditrecompileallrequired msgid "Recompile all required" msgstr "" #: lazarusidestrconsts:lispckeditcreatemakefile msgid "Create Makefile" msgstr "" #: lazarusidestrconsts:lispckeditaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts:lispckeditinstall msgid "Install" msgstr "Instalovat" #: lazarusidestrconsts:lispckedituninstall msgid "Uninstall" msgstr "Odinstalovat" #: lazarusidestrconsts:lispckeditviewpackgesource msgid "View Package Source" msgstr "Zobrazit zdroj balíkču" #: lazarusidestrconsts:lispeviewtodolist msgid "View ToDo list" msgstr "Zobrazit seznam úkolů" #: lazarusidestrconsts:lispckeditgeneraloptions msgid "General Options" msgstr "Obecná nastavení" #: lazarusidestrconsts:lispckeditsavechanges msgid "Save Changes?" msgstr "" #: lazarusidestrconsts:lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" msgstr "" #: lazarusidestrconsts:lispckeditpage msgid "%s, Page: %s" msgstr "%s,Stránka: %s" #: lazarusidestrconsts:lispckeditremovefile2 msgid "Remove file?" msgstr "Odstranit soubor?" #: lazarusidestrconsts:lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgstr "Odstranit soubor %s%s%s%sz balíčku %s%s%s?" #: lazarusidestrconsts:lispckeditremovedependency2 msgid "Remove Dependency?" msgstr "" #: lazarusidestrconsts:lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "" #: lazarusidestrconsts:lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "" #: lazarusidestrconsts:lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts:lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "" #: lazarusidestrconsts:lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "" #: lazarusidestrconsts:lispckeditcompileeverything msgid "Compile everything?" msgstr "Přeložit vše?" #: lazarusidestrconsts:lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "" #: lazarusidestrconsts:lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" msgstr "Volby překladače pro balíček %s" #: lazarusidestrconsts:lispckeditsavepackage msgid "Save package" msgstr "" #: lazarusidestrconsts:lispckeditcompilepackage msgid "Compile package" msgstr "Kompilovat balíček" #: lazarusidestrconsts:lispckeditaddanitem msgid "Add an item" msgstr "Přidat položku" #: lazarusidestrconsts:lispckeditremoveselecteditem msgid "Remove selected item" msgstr "" #: lazarusidestrconsts:lispckeditinstallpackageintheide msgid "Install package in the IDE" msgstr "Instalovat balíček do IDE" #: lazarusidestrconsts:lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Upravit obecné nastavení" #: lazarusidestrconsts:lispckeditcompopts msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts:lispckedithelp msgid "Help" msgstr "Nápověda" #: lazarusidestrconsts:lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" msgstr "" #: lazarusidestrconsts:lispckeditmore msgid "More ..." msgstr "Více..." #: lazarusidestrconsts:lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Upravit nastavení pro překlad balíčku" #: lazarusidestrconsts:lispckeditrequiredpackages msgid "Required Packages" msgstr "Požadované balíčky" #: lazarusidestrconsts:lispckeditfileproperties msgid "File Properties" msgstr "Vlastnosti souboru" #: lazarusidestrconsts:lispckeditregisterunit msgid "Register unit" msgstr "" #: lazarusidestrconsts:lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Volání %sRegistr%s procedura vybrané jednotky" #: lazarusidestrconsts:lispckeditregisteredplugins msgid "Registered plugins" msgstr "" #: lazarusidestrconsts:lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "Přidat jednotku do sekce uses v balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány." #: lazarusidestrconsts:lispkgmanguseunit msgid "Use unit" msgstr "Požít jednotku" #: lazarusidestrconsts:lispckeditminimumversion msgid "Minimum Version:" msgstr "Minimální verze:" #: lazarusidestrconsts:lispckeditmaximumversion msgid "Maximum Version:" msgstr "Maximální verze:" #: lazarusidestrconsts:lispckeditapplychanges msgid "Apply changes" msgstr "Použít změny" #: lazarusidestrconsts:lispckeditpackage msgid "Package %s" msgstr "Balíček %s" #: lazarusidestrconsts:lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts:lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" msgstr "" #: lazarusidestrconsts:lispckeditdependencyproperties msgid "Dependency Properties" msgstr "Vlastnsoti závislosti" #: lazarusidestrconsts:lispckeditpackagenotsaved msgid "package %s not saved" msgstr "balíček %s nenalezen" #: lazarusidestrconsts:lispckeditreadonly msgid "Read Only: %s" msgstr "Pouze pro čtení: %s" #: lazarusidestrconsts:lispckeditmodified msgid "Modified: %s" msgstr "Změněný: %s" #: lazarusidestrconsts:lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Nová jednotka není v cestě jednotek" #: lazarusidestrconsts:lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" msgstr "" #: lazarusidestrconsts:lispkgeditrevertpackage msgid "Revert package?" msgstr "" #: lazarusidestrconsts:lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?" #: lazarusidestrconsts:lispckoptsusage msgid "Usage" msgstr "Použití" #: lazarusidestrconsts:lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "Vyberte adresář .po souborů" #: lazarusidestrconsts:lispckoptsideintegration msgid "IDE Integration" msgstr "" #: lazarusidestrconsts:lispckoptsprovides msgid "Provides" msgstr "Poskytuje" #: lazarusidestrconsts:lispckoptsdescriptionabstract msgid "Description/Abstract" msgstr "Popis/obsah" #: lazarusidestrconsts:lispckoptsauthor msgid "Author:" msgstr "Autor:" #: lazarusidestrconsts:lispckoptslicense msgid "License:" msgstr "Licence:" #: lazarusidestrconsts:lispckoptsmajor msgid "Major" msgstr "Hlavní" #: lazarusidestrconsts:lispckoptsminor msgid "Minor" msgstr "Minoritní" #: lazarusidestrconsts:lispckoptsrelease msgid "Release" msgstr "Uvolnění" #: lazarusidestrconsts:lisbuildnumber msgid "Build Number" msgstr "Číslo sestavení" #: lazarusidestrconsts:lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" msgstr "Automaticky zvyšovat číslo verze při sestavení" #: lazarusidestrconsts:lispckoptspackagetype msgid "PackageType" msgstr "" #: lazarusidestrconsts:lispckoptsdesigntimeonly msgid "Designtime only" msgstr "Pouze doba návrhu" #: lazarusidestrconsts:lispckoptsruntimeonly msgid "Runtime only" msgstr "Pouze běhový" #: lazarusidestrconsts:lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" msgstr "Doba návrhu a doba kompilace" #: lazarusidestrconsts:lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "Aktualizovat/Znovu sestavit" #: lazarusidestrconsts:lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Automaticky znovu sestavit podle potřeby" #: lazarusidestrconsts:lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Automaticky znovu sestav pokud znovu sestavení všeho" #: lazarusidestrconsts:lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "" #: lazarusidestrconsts:lispckoptslazdoclazarusdocumentation msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts:lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Přidat cesty do závislých balíčků/projektů" #: lazarusidestrconsts:lispckoptsinclude msgid "Include" msgstr "" #: lazarusidestrconsts:lispckoptsobject msgid "Object" msgstr "Objekt" #: lazarusidestrconsts:lispckoptslibrary msgid "Library" msgstr "Knihovna" #: lazarusidestrconsts:lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Přidat volby do závislých balíčků a projektů" #: lazarusidestrconsts:lispckoptslinker msgid "Linker" msgstr "" #: lazarusidestrconsts:lispckoptscustom msgid "Custom" msgstr "Vlastní" #: lazarusidestrconsts:lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "Neplatný typ balíčku" #: lazarusidestrconsts:lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgstr "" #: lazarusidestrconsts:lispckoptspackageoptions msgid "Package Options" msgstr "" #: lazarusidestrconsts:lispckexplloadedpackages msgid "Loaded Packages:" msgstr "" #: lazarusidestrconsts:lispckexplisrequiredby msgid "Selected package is required by:" msgstr "" #: lazarusidestrconsts:lispckexplpackagenotfound msgid "Package %s not found" msgstr "Balíček %s nenalezen" #: lazarusidestrconsts:lispckexplstate msgid "%sState: " msgstr "%sStav: " #: lazarusidestrconsts:lispckexplautocreated msgid "AutoCreated" msgstr "Automaticky vytvořeno" #: lazarusidestrconsts:lispckexplinstalled msgid "Installed" msgstr "Instalováno" #: lazarusidestrconsts:lispckexplinstallonnextstart msgid "Install on next start" msgstr "Instalovat při dalším spuštění" #: lazarusidestrconsts:lispckexpluninstallonnextstart msgid "Uninstall on next start" msgstr "Odinstalovat při dalším spuštění" #: lazarusidestrconsts:lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "" #: lazarusidestrconsts:lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "" #: lazarusidestrconsts:lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" msgstr "Odstranit závislost pro %s?" #: lazarusidestrconsts:lisprojinspremovefilefromproject msgid "Remove file %s from project?" msgstr "Odstranit soubor %s z projektu?" #: lazarusidestrconsts:lisprojinspremovedrequiredpackages msgid "Removed required packages" msgstr "" #: lazarusidestrconsts:lisprojinspprojectinspector msgid "Project Inspector - %s" msgstr "" #: lazarusidestrconsts:lisfpfindpalettecomponent msgid "Find palette component" msgstr "" #: lazarusidestrconsts:lisfpcomponents msgid "Components" msgstr "Komponenty" #: lazarusidestrconsts:liscmplstcomponents msgid "Components" msgstr "Komponenty" #: lazarusidestrconsts:liscmplstlist msgid "List" msgstr "Seznam" #: lazarusidestrconsts:liscmplstpalette msgid "Palette" msgstr "Paleta" #: lazarusidestrconsts:liscmplstinheritance msgid "Inheritance" msgstr "Dědičnost" #: lazarusidestrconsts:lismenueditormenueditor msgid "Menu Editor" msgstr "Editor menu" #: lazarusidestrconsts:lismenueditorselectmenu msgid "Select Menu:" msgstr "" #: lazarusidestrconsts:lismenueditorselecttemplate msgid "Select Template:" msgstr "" #: lazarusidestrconsts:lismenueditortemplatepreview msgid "Template Preview" msgstr "Náhled šablony" #: lazarusidestrconsts:lismenueditornewtemplatedescription msgid "New Template Description..." msgstr "Nový popis šablony..." #: lazarusidestrconsts:lismenueditorcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts:lismenueditorinsertnewitemafter msgid "Insert New Item (after)" msgstr "" #: lazarusidestrconsts:lismenueditorinsertnewitembefore msgid "Insert New Item (before)" msgstr "" #: lazarusidestrconsts:lismenueditordeleteitem msgid "Delete Item" msgstr "Odstranit položku" #: lazarusidestrconsts:lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "" #: lazarusidestrconsts:lismenueditorhandleonclickevent msgid "Handle OnClick Event" msgstr "" #: lazarusidestrconsts:lismenueditormoveup msgid "Move Up (or left)" msgstr "" #: lazarusidestrconsts:lismenueditormovedown msgid "Move Down (or right)" msgstr "" #: lazarusidestrconsts:lismenueditorinsertfromtemplate msgid "Insert From Template..." msgstr "" #: lazarusidestrconsts:lismenueditorsaveastemplate msgid "Save As Template..." msgstr "Uložit jako šablonu..." #: lazarusidestrconsts:lismenueditordeletefromtemplate msgid "Delete From Template..." msgstr "Odstranit ze šablony..." #: lazarusidestrconsts:lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" msgstr "" #: lazarusidestrconsts:lismenutemplatefile msgid "File" msgstr "Soubor" #: lazarusidestrconsts:lismenutemplatenew msgid "New" msgstr "Nový" #: lazarusidestrconsts:liskmnewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts:lismenutemplateopen msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts:lismenutemplateopenrecent msgid "Open Recent" msgstr "Otevřít nedávný" #: lazarusidestrconsts:lismenutemplatesave msgid "Save" msgstr "Uložit" #: lazarusidestrconsts:lismenutemplatesaveas msgid "Save As" msgstr "Uložit jako" #: lazarusidestrconsts:lismenutemplateclose msgid "Close" msgstr "Zavřít" #: lazarusidestrconsts:lismenutemplateexit msgid "Exit" msgstr "Ukončit" #: lazarusidestrconsts:lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" msgstr "" #: lazarusidestrconsts:lismenutemplateedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts:lismenutemplateundo msgid "Undo" msgstr "" #: lazarusidestrconsts:lismenutemplateredo msgid "Redo" msgstr "" #: lazarusidestrconsts:lismenutemplatecut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts:lismenutemplatecopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts:lismenutemplatepaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts:lismenutemplatefind msgid "Find" msgstr "Najít" #: lazarusidestrconsts:lismenutemplatefindnext msgid "Find Next" msgstr "Najít další" #: lazarusidestrconsts:lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" msgstr "" #: lazarusidestrconsts:lismenutemplatehelp msgid "Help" msgstr "Nápověda" #: lazarusidestrconsts:lismenutemplatecontents msgid "Contents" msgstr "Obsah" #: lazarusidestrconsts:lismenutemplatetutorial msgid "Tutorial" msgstr "" #: lazarusidestrconsts:lismenutemplateabout msgid "About" msgstr "O aplikaci" #: lazarusidestrconsts:liscontributors msgid "Contributors" msgstr "Přispěvatelé" #: lazarusidestrconsts:lisacknowledgements msgid "Acknowledgements" msgstr "Poděkování" #: lazarusidestrconsts:lischaractermap msgid "Character Map" msgstr "Mapa znaků" #: lazarusidestrconsts:lisctdefchoosedirectory msgid "Choose Directory" msgstr "Vyberte adresář" #: lazarusidestrconsts:lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "" #: lazarusidestrconsts:lisctdefvariable msgid "Variable: %s" msgstr "Proměnná: %s" #: lazarusidestrconsts:lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts:lisctdefvariablename msgid "Variable Name" msgstr "Jméno proměné" #: lazarusidestrconsts:liscldircleansubdirectories msgid "Clean sub directories" msgstr "Vyčistit podadresáře" #: lazarusidestrconsts:liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "" #: lazarusidestrconsts:liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Jednoduchá syntaxe (např. * namísto .*)" #: lazarusidestrconsts:liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Udržovat všechny textové soubory" #: lazarusidestrconsts:liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "" #: lazarusidestrconsts:liscldircleandirectory msgid "Clean Directory" msgstr "Vyčistit adresář" #: lazarusidestrconsts:listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgstr "" #: lazarusidestrconsts:lisfixlfmfile msgid "Fix LFM file" msgstr "" #: lazarusidestrconsts:lismissingevents msgid "Missing Events" msgstr "Chybějící události" #: lazarusidestrconsts:listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgstr "" #: lazarusidestrconsts:lisnocodeselected msgid "No code selected" msgstr "Nevybraný žádný kód" #: lazarusidestrconsts:lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts:lisinvalidselection msgid "Invalid selection" msgstr "" #: lazarusidestrconsts:listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts:lisextractprocedure msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts:lisnameofnewprocedure msgid "Name of new procedure" msgstr "Jméno nové procedury" #: lazarusidestrconsts:lisextract msgid "Extract" msgstr "" #: lazarusidestrconsts:lisinvalidprocname msgid "Invalid proc name" msgstr "" #: lazarusidestrconsts:lispublicmethod msgid "Public Method" msgstr "" #: lazarusidestrconsts:lisprivatemethod msgid "Private Method" msgstr "Soukromá metoda" #: lazarusidestrconsts:lisprotectedmethod msgid "Protected Method" msgstr "Chráněné metody" #: lazarusidestrconsts:lispublishedmethod msgid "Published Method" msgstr "Zveřejněné metody" #: lazarusidestrconsts:lisprocedure msgid "Procedure" msgstr "Procedura" #: lazarusidestrconsts:lisprocedurewithinterface msgid "Procedure with interface" msgstr "Procedurea s rozhranním" #: lazarusidestrconsts:lissubprocedure msgid "Sub Procedure" msgstr "" #: lazarusidestrconsts:lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "" #: lazarusidestrconsts:lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "" #: lazarusidestrconsts:listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." msgstr "" #: lazarusidestrconsts:lisinvalidcompilerfilename msgid "Invalid Compiler Filename" msgstr "" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" msgstr "" #: lazarusidestrconsts:listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" msgstr "" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lislazarusdirectorynotfound msgid "Lazarus directory not found" msgstr "" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts:lishlpoptshelpoptions msgid "Help Options" msgstr "Volby nápovědy" #: lazarusidestrconsts:lishlpoptsviewers msgid "Viewers" msgstr "Zobrazovače" #: lazarusidestrconsts:lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "" #: lazarusidestrconsts:lishlpoptsproperties msgid "Properties:" msgstr "Vlastnosti:" #: lazarusidestrconsts:lishlpoptsdatabases msgid "Databases" msgstr "Databáze" #: lazarusidestrconsts:lisencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts:lisenclose msgid "Enclose" msgstr "" #: lazarusidestrconsts:lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "" #: lazarusidestrconsts:liserrors msgid "Errors" msgstr "Chyby" #: lazarusidestrconsts:lislfmfile msgid "LFM file" msgstr "" #: lazarusidestrconsts:lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "" #: lazarusidestrconsts:liscomptest msgid "Test" msgstr "Test" #: lazarusidestrconsts:lisa2pswitchpaths msgid "Switch Paths" msgstr "" #: lazarusidestrconsts:lisa2paddfilestopackage msgid "Add files to package" msgstr "Přidat soubory do balíčku" #: lazarusidestrconsts:lisa2paddtopackage msgid "Add to package" msgstr "Přidat do balíčku" #: lazarusidestrconsts:lisa2pfilename2 msgid "Filename" msgstr "Jméno souboru" #: lazarusidestrconsts:lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "" #: lazarusidestrconsts:lishelpselectordialog msgid "Help selector" msgstr "" #: lazarusidestrconsts:lisselectahelpitem msgid "Select a help item:" msgstr "" #: lazarusidestrconsts:liserrormovingcomponent msgid "Error moving component" msgstr "Chyba přesunu komponenty" #: lazarusidestrconsts:liserrormovingcomponent2 msgid "Error moving component %s:%s" msgstr "Chyba přesunu komponenty %s:%s" #: lazarusidestrconsts:lisinstalledpackages msgid "Installed Packages" msgstr "" #: lazarusidestrconsts:lisavailablepackages msgid "Available packages" msgstr "Dostupné balíčky" #: lazarusidestrconsts:lisexportlist msgid "Export list" msgstr "" #: lazarusidestrconsts:lisimportlist msgid "Import list" msgstr "" #: lazarusidestrconsts:lisuninstallselection msgid "Uninstall selection" msgstr "Odinstalovat vybrané?" #: lazarusidestrconsts:lispackagestoinstallintheide msgid "Packages to install in the IDE" msgstr "" #: lazarusidestrconsts:lisinstallselection msgid "Install selection" msgstr "Instalovat výběr" #: lazarusidestrconsts:lispackageinfo msgid "Package Info" msgstr "" #: lazarusidestrconsts:lissaveandrebuildide msgid "Save and rebuild IDE" msgstr "Uložit a znovu sestavit IDE" #: lazarusidestrconsts:lissaveandexitdialog msgid "Save and exit dialog" msgstr "Uložit a ukončovací dialog" #: lazarusidestrconsts:lisalignment msgid "Alignment" msgstr "Zarovnání" #: lazarusidestrconsts:lishorizontal msgid "Horizontal" msgstr "Horizontální" #: lazarusidestrconsts:lisnochange msgid "No change" msgstr "Žádné změny" #: lazarusidestrconsts:listops msgid "Tops" msgstr "" #: lazarusidestrconsts:lisleftsides msgid "Left sides" msgstr "" #: lazarusidestrconsts:liscenters msgid "Centers" msgstr "Vystředit" #: lazarusidestrconsts:lisbottoms msgid "Bottoms" msgstr "Spodní části" #: lazarusidestrconsts:lisrightsides msgid "Right sides" msgstr "" #: lazarusidestrconsts:liscenterinwindow msgid "Center in window" msgstr "Vystředit v okně" #: lazarusidestrconsts:lisspaceequally msgid "Space equally" msgstr "" #: lazarusidestrconsts:listopspaceequally msgid "Top space equally" msgstr "" #: lazarusidestrconsts:lisbottomspaceequally msgid "Bottom space equally" msgstr "Dolní prostor stejnoměrně" #: lazarusidestrconsts:lisleftspaceequally msgid "Left space equally" msgstr "" #: lazarusidestrconsts:lisrightspaceequally msgid "Right space equally" msgstr "" #: lazarusidestrconsts:lisvertical msgid "Vertical" msgstr "Svislý" #: lazarusidestrconsts:lisscalingfactor msgid "Scaling factor:" msgstr "" #: lazarusidestrconsts:liscustomprogram msgid "Custom Program" msgstr "" #: lazarusidestrconsts:lisprogram msgid "Program" msgstr "Program" #: lazarusidestrconsts:lisconsoleapplication msgid "Console application" msgstr "Konzolová aplikace" #: lazarusidestrconsts:lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts:lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts:liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." msgstr "" #: lazarusidestrconsts:lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." msgstr "" #: lazarusidestrconsts:lisnpselectaprojecttype msgid "Select a project type" msgstr "" #: lazarusidestrconsts:lisnpcreateanewproject msgid "Create a new project" msgstr "" #: lazarusidestrconsts:lisnpcreate msgid "Create" msgstr "Vytvořit" #: lazarusidestrconsts:lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "Vyberte základní třídu pro oblíbené vlastnosti %s%s%s." #: lazarusidestrconsts:lisoifaddtofavouriteproperties msgid "Add to favourite properties" msgstr "Přidat do oblíbených vlastností" #: lazarusidestrconsts:lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" msgstr "" #: lazarusidestrconsts:lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "Nahrazení výběru selhalo." #: lazarusidestrconsts:lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." msgstr "" #: lazarusidestrconsts:liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "Chyba analýzy komponentového proudu lfm." #: lazarusidestrconsts:lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "" #: lazarusidestrconsts:lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "Nelze získat zdroj pro návrhář." #: lazarusidestrconsts:lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "Nelze získat změny v editoru." #: lazarusidestrconsts:lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "" #: lazarusidestrconsts:lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" msgstr "%s%sNelze změnit jméno třídy %s na %s" #: lazarusidestrconsts:liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "Změnit lze pouze třídu dědící TComponent." #: lazarusidestrconsts:lisoldclass msgid "Old Class" msgstr "" #: lazarusidestrconsts:lisnewclass msgid "New Class" msgstr "Nová třída" #: lazarusidestrconsts:lisoldancestors msgid "Old Ancestors" msgstr "" #: lazarusidestrconsts:lisnewancestors msgid "New Ancestors" msgstr "Nový předek" #: lazarusidestrconsts:liscemodeshowcategories msgid "Show Categories" msgstr "" #: lazarusidestrconsts:liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "" #: lazarusidestrconsts:lisceocodeexplorer msgid "CodeExplorer Options" msgstr "" #: lazarusidestrconsts:lisceoupdate msgid "Update" msgstr "Aktualizovat" #: lazarusidestrconsts:lisceorefreshautomatically msgid "Refresh automatically" msgstr "" #: lazarusidestrconsts:lisceoneveronlymanually msgid "Never, only manually" msgstr "Nikdy, pouze ručně" #: lazarusidestrconsts:lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "Když přepínání souboru v zdrojovém editoru" #: lazarusidestrconsts:lisceoonidle msgid "On idle" msgstr "" #: lazarusidestrconsts:liscefollowcursor msgid "Follow cursor" msgstr "" #: lazarusidestrconsts:liscecategories msgid "Categories" msgstr "Skupiny" #: lazarusidestrconsts:lisceuses msgid "Uses" msgstr "Užití" #: lazarusidestrconsts:lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "" #: lazarusidestrconsts:liscetypes msgid "Types" msgstr "Typy" #: lazarusidestrconsts:liscevariables msgid "Variables" msgstr "Proměnné" #: lazarusidestrconsts:lisceconstants msgid "Constants" msgstr "Konstanty" #: lazarusidestrconsts:lisceprocedures msgid "Procedures" msgstr "Procedury" #: lazarusidestrconsts:lisceproperties msgid "Properties" msgstr "Vlastnosti" #: lazarusidestrconsts:lisceomode msgid "Preferred Exhibition Mode" msgstr "" #: lazarusidestrconsts:lisceomodecategory msgid "Category" msgstr "Skupina" #: lazarusidestrconsts:lisceomodesource msgid "Source" msgstr "Zdroj" #: lazarusidestrconsts:lismenufpdoceditor msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts:liscodehelpmainformcaption msgid "FPDoc editor" msgstr "" #: lazarusidestrconsts:liscodehelpnotagcaption msgid "" msgstr "<ŽÁDNÝ>" #: lazarusidestrconsts:liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "(nenalezen zděděný popis)" #: lazarusidestrconsts:liscodehelpshortdescriptionof msgid "Short description of" msgstr "Krátky popis " #: lazarusidestrconsts:liscodehelpnodocumentation msgid "(none)" msgstr "(žádný)" #: lazarusidestrconsts:liscodehelpinherited msgid "Inherited" msgstr "Zděděný" #: lazarusidestrconsts:liscodehelpshorttag msgid "Short" msgstr "Krátký" #: lazarusidestrconsts:liscodehelpdescrtag msgid "Description" msgstr "Popis" #: lazarusidestrconsts:liscodehelperrorstag msgid "Errors" msgstr "Chyby" #: lazarusidestrconsts:liscodehelpseealsotag msgid "See also" msgstr "Související informace" #: lazarusidestrconsts:liscodehelpaddpathbutton msgid "Add path" msgstr "Přidat cestu" #: lazarusidestrconsts:liscodehelpdeletepathbutton msgid "Remove path" msgstr "Odstranit cestu" #: lazarusidestrconsts:liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" msgstr "POZNÁMKA: nyní jsou podporovány pouze plné cesty" #: lazarusidestrconsts:liscodehelpconfirmreplace msgid "Confirm replace" msgstr "Potvrdit nahrazení" #: lazarusidestrconsts:liscodehelpreplacebutton msgid "Replace" msgstr "Nahradit" #: lazarusidestrconsts:liscodehelppathsgroupbox msgid "FPDoc files path" msgstr "" #: lazarusidestrconsts:liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelphintvartag msgid "Insert var formatting tag" msgstr "" #: lazarusidestrconsts:liscodehelpaddlinkbutton msgid "Add link" msgstr "Přidat odkaz" #: lazarusidestrconsts:liscodehelpdeletelinkbutton msgid "Delete link" msgstr "Odstranit vazbu" #: lazarusidestrconsts:liscodehelpcreatebutton msgid "Create help item" msgstr "Vytvořit položku nápovědy" #: lazarusidestrconsts:liscodehelpinsertalink msgid "Insert a link ..." msgstr "Vložit odkaz..." #: lazarusidestrconsts:liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "Vložit značku formátování odstavce" #: lazarusidestrconsts:liscodehelpsavebutton msgid "Save" msgstr "Uložit" #: lazarusidestrconsts:liscodehelpexampletag msgid "Example" msgstr "Příklad" #: lazarusidestrconsts:liscodehelpbrowseexamplebutton msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts:lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "Přesunout položky do zděděného" #: lazarusidestrconsts:lisldcopyfrominherited msgid "Copy from inherited" msgstr "Kopírovat ze zděděného" #: lazarusidestrconsts:lisldaddlinktoinherited msgid "Add link to inherited" msgstr "Přidat odkaz ke zděděnému" #: lazarusidestrconsts:lisenablemacros msgid "Enable Macros" msgstr "Povolit makra" #: lazarusidestrconsts:lisctselectcodemacro msgid "Select Code Macro" msgstr "Vybrat makro kódu" #: lazarusidestrconsts:lispdprogress msgid "Progress" msgstr "Průběh" #: lazarusidestrconsts:lispdabort msgid "Abort" msgstr "Přerušit" #: lazarusidestrconsts:lisposaveinlpifil msgid "Save in .lpi file" msgstr "Uložit v souboru .lpi" #: lazarusidestrconsts:lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "Uložit v souboru .lps v adresáři projektu" #: lazarusidestrconsts:lisposaveinideconfigdirectory msgid "Save in IDE config directory" msgstr "Uložit v konfiguračním adresáři IDE" #: lazarusidestrconsts:lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "Neukládat žádné informace o sezení" #: lazarusidestrconsts:lisposavesessioninformationin msgid "Save session information in" msgstr "Uložit informace sezení v" #: lazarusidestrconsts:lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Uložit zprávy do souboru (*.txt)" #: lazarusidestrconsts:lisshowoldtaborder msgid "Show old tab order" msgstr "Ukázat staré pořadí záložek" #: lazarusidestrconsts:listaborderof msgid "Tab Order of" msgstr "Pořadí záložek" #: lazarusidestrconsts:lisanchorenabledhint msgid "Enabled = Include %s in Anchors" msgstr "Povolený = Včetně %s v kotvách" #: lazarusidestrconsts:lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "Okrajový prostor kolem ovládacího prvku. Další čtyři okrajové prostory jsou přidány k této hodnotě." #: lazarusidestrconsts:listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "Horní okrajový prostor. Tato hodnota je přidána jako základ okrajového prostoru a použta pro prostor nad prvkem." #: lazarusidestrconsts:lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "Dolní okrajový prostor. Tato hodnota je přidána k základnímu okraji a je použita pro místo pod prvkem." #: lazarusidestrconsts:lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "" #: lazarusidestrconsts:lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "" #: lazarusidestrconsts:liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling" msgstr "" #: lazarusidestrconsts:liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" msgstr "" #: lazarusidestrconsts:lisanchortotopsidekeepborderspace msgid "Anchor to top side of sibling, keep border space" msgstr "Ukotvit k horní straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts:lisanchortobottomsidekeepborderspace msgid "Anchor to bottom side of sibling, keep border space" msgstr "Ukotvit k dolní straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts:lisanchortoleftsidekeepborderspace msgid "Anchor to left side of sibling, keep border space" msgstr "Ukotvit k levé straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts:lisanchortorightsidekeepborderspace msgid "Anchor to right side of sibling, keep border space" msgstr "Ukotvit k pravý straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts:listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts:lisborderspace msgid "BorderSpace" msgstr "Okrajový prostor" #: lazarusidestrconsts:lissibling msgid "Sibling" msgstr "" #: lazarusidestrconsts:lisenabled msgid "Enabled" msgstr "Povolený" #: lazarusidestrconsts:lisrightanchoring msgid "Right anchoring" msgstr "" #: lazarusidestrconsts:listopanchoring msgid "Top anchoring" msgstr "Přichycení nahoru" #: lazarusidestrconsts:lisleftgroupboxcaption msgid "Left anchoring" msgstr "" #: lazarusidestrconsts:lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "Dolní ukotvení" #: lazarusidestrconsts:lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "Nelze nastavit AnchorSide Control" #: lazarusidestrconsts:lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "Editor ukotvení - nevybrán žádný ovládací prvek" #: lazarusidestrconsts:lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "Ukotvení vybraného ovládacího prvku" #: lazarusidestrconsts:lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Doplňující prohledávací cesty" #: lazarusidestrconsts:lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Obecná nastavení ladícího nástroje" #: lazarusidestrconsts:lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "Zobrazit hlášení při zastavení" #: lazarusidestrconsts:lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "Speciální nastavení pro ladič (záleží na typu ladiče)" #: lazarusidestrconsts:lisdebugoptionsfrmeventlog msgid "Event Log" msgstr "Záznam událostí" #: lazarusidestrconsts:lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Smazat záznam při spuštění" #: lazarusidestrconsts:lisdebugoptionsfrmlimitlinecountto msgid "Limit linecount to" msgstr "Omezit počet řádek na" #: lazarusidestrconsts:lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Bod přerušení" #: lazarusidestrconsts:lisdebugoptionsfrmprocess msgid "Process" msgstr "Proces" #: lazarusidestrconsts:lisdebugoptionsfrmthread msgid "Thread" msgstr "Vlákno" #: lazarusidestrconsts:lisdebugoptionsfrmmodule msgid "Module" msgstr "Modul" #: lazarusidestrconsts:lisdebugoptionsfrmoutput msgid "Output" msgstr "Výstup" #: lazarusidestrconsts:lisdebugoptionsfrmwindow msgid "Window" msgstr "Okno" #: lazarusidestrconsts:lisdebugoptionsfrminterface msgid "Interface" msgstr "Rozhraní" #: lazarusidestrconsts:lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "Vyjímky jazyku" #: lazarusidestrconsts:lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "Ignorovat tyto vyjímky" #: lazarusidestrconsts:lisdebugoptionsfrmbreakonlazarusexceptions msgid "Break on Lazarus Exceptions" msgstr "Přerušit při vyjímce Lazarusu" #: lazarusidestrconsts:lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "Vyjímky OS" #: lazarusidestrconsts:lisdebugoptionsfrmsignals msgid "Signals" msgstr "Signály" #: lazarusidestrconsts:lisdebugoptionsfrmname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts:lisdebugoptionsfrmid msgid "ID" msgstr "ID" #: lazarusidestrconsts:lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "Obslouženo" #: lazarusidestrconsts:lisdebugoptionsfrmresume msgid "Resume" msgstr "Obnovit" #: lazarusidestrconsts:lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "Obslouženo programem" #: lazarusidestrconsts:lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "Obslouženo ladícím nástrojem" #: lazarusidestrconsts:lisdebugoptionsfrmresumehandled msgid "Resume Handled" msgstr "Obnovit jako obsloužené" #: lazarusidestrconsts:lisdebugoptionsfrmresumeunhandled msgid "Resume Unhandled" msgstr "Obnovit jako neobsloužené" #: lazarusidestrconsts:dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "Editor cest" #: lazarusidestrconsts:lishfmhelpforfreepascalcompilermessage msgid "Help for FreePascal Compiler message" msgstr "Nápověda pro zprávy překladače FreePascalu" #: lazarusidestrconsts:lisrelativepaths msgid "Relative paths" msgstr "Relativní cesty" #: lazarusidestrconsts:lislazbuildsavesettings msgid "Save settings" msgstr "Uložit nastavení" #: lazarusidestrconsts:rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" msgstr "Datový soubor formuláře (*.dfm)|*.dfm" #: lazarusidestrconsts:liswlwatchlist msgid "Watch list" msgstr "Seznam sledování" #: lazarusidestrconsts:liswlexpression msgid "Expression" msgstr "Výraz" #: lazarusidestrconsts:liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "Vyberte schéma mapování kláves" #: lazarusidestrconsts:liskmnoteallkeyswillbesettothevaluesofthechoosenscheme msgid "Note: All keys will be set to the values of the choosen scheme." msgstr "Poznámka: Všechny klávesy budou nastaveny na hodnoty podle vybraného schéma." #: lazarusidestrconsts:liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "Schéma mapování kláves" #: lazarusidestrconsts:lisifdok msgid "OK" msgstr "OK" #: lazarusidestrconsts:lispvueditvirtualunit msgid "Edit virtual unit" msgstr "Upravit virtuální jednotku" #: lazarusidestrconsts:versioninfotitle msgid "Version Info" msgstr "Informace o verzi" #: lazarusidestrconsts:lisplistobjects msgid "&Objects" msgstr "&Objekty" #: lazarusidestrconsts:lisplistjumptoselection msgid "Jump To Selection" msgstr "Skoč na výběr" #: lazarusidestrconsts:lisplistfilterany msgid "Filter by matching any part of method" msgstr "Filtrovat podle jakékoliv odpovídající části metody" #: lazarusidestrconsts:lisplistfilterstart msgid "Filter by matching with start of method" msgstr "Filtrovat podle začátku metody" #: lazarusidestrconsts:lisplistchangefont msgid "Change Font" msgstr "Změnit písmo" #: lazarusidestrconsts:lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "Zkopírovat jméno metody do schránky" #: lazarusidestrconsts:lisplisttype msgid "Type" msgstr "Typ" #: lazarusidestrconsts:lisplistall msgid "" msgstr "" #: lazarusidestrconsts:lisplistnone msgid "" msgstr "<žádný>" #: lazarusidestrconsts:lisuiclearincludedbyreference msgid "Clear include cache" msgstr "Smazat vyrovnávací paměť pro include" #: lazarusidestrconsts:lischangeparent msgid "Change parent ..." msgstr "Změnit rodiče..." #: lazarusidestrconsts:lislazaruside msgid "Lazarus IDE" msgstr "Lazarus IDE" #: lazarusidestrconsts:lisdirectives msgid "Directives" msgstr "Pokyny" #: lazarusidestrconsts:rscreatenewdefine msgid "Create new define" msgstr "Vytvořit novou definici" #: lazarusidestrconsts:rsconditionaldefines msgid "Conditional defines" msgstr "Podmíněné definice" #: lazarusidestrconsts:rsaddinverse msgid "Add Inverse" msgstr "Přidat inverzi" #: lazarusidestrconsts:rsremove msgid "&Remove" msgstr "&Odstranit" #: lazarusidestrconsts:lisautomaticallyonlinebreak msgid "line break" msgstr "odsazení řádku" #: lazarusidestrconsts:lisautomaticallyonspace msgid "space" msgstr "mezera" #: lazarusidestrconsts:lisautomaticallyonwordend msgid "word end" msgstr "konec slova" #: lazarusidestrconsts:lisautomaticallyremovecharacter msgid "do not add character" msgstr "nepřidávat znak" #: lazarusidestrconsts:lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "Tento balíček poskytuje to samé jako následující balíčky:" #: lazarusidestrconsts:lispldpackagelinks msgid "Package Links" msgstr "Odakzy balíčku" #: lazarusidestrconsts:lissamoverridefirstselected msgid "Override first selected" msgstr "Přepsat první vybraný" #: lazarusidestrconsts:lissamoverrideallselected msgid "Override all selected" msgstr "Přepsat celý výběr" #: lazarusidestrconsts:lisccdnoclass msgid "no class" msgstr "žádná třída" #: lazarusidestrconsts:lisccdchangeclassof msgid "Change Class of %s" msgstr "Změnit třídu %s" #: lazarusidestrconsts:lisvsrsearchorfilterphrasesinlist msgid "Search or Filter Phrases In List" msgstr "Hledat nebo filtrovat fráze v seznamu" #: lazarusidestrconsts:lisvsrforwardsearch msgid "Forward Search" msgstr "Dopředné hledání" #: lazarusidestrconsts:lisvsrresetresultlist msgid "Reset Result List" msgstr "Resetovat seznam výsledků" #: lazarusidestrconsts:listddinserttodo msgid "Insert ToDo" msgstr "Vložit úkol" #: lazarusidestrconsts:lisabcreationfailed msgid "Error occured during Application Bundle creation: " msgstr "Nastala chyba během vytváření balíku aplikace:" #: lazarusidestrconsts:lisunabletowrite2 msgid "Unable to write %s%s%s" msgstr "Nelze zapisovat do %s%s%s" #: lazarusidestrconsts:liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" msgstr "Chyba načítání %s z%s%s%s%s" #: lazarusidestrconsts:liserrorsavingto msgid "Error saving %s to%s%s%s%s" msgstr "Cyba ukládání %s do %s%s%s%s" #: lazarusidestrconsts:lisxmlerror msgid "XML Error" msgstr "Chyba XML" #: lazarusidestrconsts:lisxmlparsererrorinfileerror msgid "XML parser error in file %s%sError: %s" msgstr "Chyba XML analyzátoru v souboru %s%sChyba: %s" #: lazarusidestrconsts:lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" msgstr "Nelze zapsat xml proud do %s%sChyba: %s" #: lazarusidestrconsts:lisfileissymlink msgid "File is symlink" msgstr "Soubor je symbolický odkaz" #: lazarusidestrconsts:listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" msgstr "Soubor %s%s%s je symbolický odkaz.%s%sOtevřít místo něj %s%s%s?" #: lazarusidestrconsts:lisopentarget msgid "Open target" msgstr "Otevřít cíl" #: lazarusidestrconsts:lisopensymlink msgid "Open symlink" msgstr "Otevřít symbolický odkaz" #: lazarusidestrconsts:lisfilelinkerror msgid "File link error" msgstr "Chyba vazby souboru" #: lazarusidestrconsts:liswriteerrorfile msgid "Write error: %s%sFile: %s%s%s" msgstr "Chyba zápisu: %s%sSoubor: %s%s%s" #: lazarusidestrconsts:lisstreamerror msgid "Stream Error" msgstr "Chyba proudu" #: lazarusidestrconsts:lisunabletoupdatethebinaryresourcefilefromfilethetext msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt." msgstr "Nelze aktualizovat binární zdrojový soubor%s%s%sz textového zdrojového souboru%s%s%s%sTextový soubor" #: lazarusidestrconsts:listhecodetoolsfoundanerror msgid "The codetools found an error:%s%s%s" msgstr "Chyba nalezená codetools:%s%s%s" #: lazarusidestrconsts:lisignoreandcontinue msgid "Ignore and continue" msgstr "Ignorovat a pokračovat" #: lazarusidestrconsts:lisnotimplemented msgid "Not implemented" msgstr "Doposud neimplementováno" #: lazarusidestrconsts:lisnotimplementedyet msgid "Not implemented yet:%s%s" msgstr "Zatím neimplementováno:%s%s" #: lazarusidestrconsts:lisopenfile2 msgid "Open File ..." msgstr "Otevřít soubor..." #: lazarusidestrconsts:lismovepage msgid "Move Page ..." msgstr "Přesunout stránku..." #: lazarusidestrconsts:lisfilesettings msgid "File Settings ..." msgstr "Nastavení souboru..." #: lazarusidestrconsts:lisshow msgid "Show" msgstr "Ukázat" #: lazarusidestrconsts:liscurrent msgid "Current" msgstr "Aktuální" #: lazarusidestrconsts:lismaxs msgid "Max %d" msgstr "Max %d" #: lazarusidestrconsts:lismore msgid "More" msgstr "Více" #: lazarusidestrconsts:listop msgid "Top" msgstr "Nahoře" #: lazarusidestrconsts:lisbottom msgid "Bottom" msgstr "Dolní" #: lazarusidestrconsts:liscopyall msgid "Copy All" msgstr "Kopírovat vše" #: lazarusidestrconsts:lisindex msgid "Index" msgstr "Index" #: lazarusidestrconsts:lisfunction msgid "Function" msgstr "Funkce" #: lazarusidestrconsts:lisfilenameaddress msgid "Filename/Address" msgstr "Jméno souboru/Adresa" #: lazarusidestrconsts:lislinelength msgid "Line/Length" msgstr "Řádek/Délka" #: lazarusidestrconsts:liscondition msgid "Condition" msgstr "Podmínka" #: lazarusidestrconsts:lispasscount msgid "Pass Count" msgstr "Počet průchodů" #: lazarusidestrconsts:lisgroup msgid "Group" msgstr "Skupina" #: lazarusidestrconsts:lissourcebreakpoint msgid "&Source breakpoint" msgstr "&Zdrojový bod přerušení" #: lazarusidestrconsts:lisenableall msgid "&Enable All" msgstr "&Editovat vše" #: lazarusidestrconsts:lisdeleteall msgid "&Delete All" msgstr "Smazat vše" #: lazarusidestrconsts:lisdisableallinsamesource msgid "Disable All in same source" msgstr "Zakázat vše ve stejném zdroji" #: lazarusidestrconsts:lisenableallinsamesource msgid "Enable All in same source" msgstr "Povolit vše ve stejném zdroji" #: lazarusidestrconsts:lisdeleteallinsamesource msgid "Delete All in same source" msgstr "Smazat vše ve stejném zdroji" #: lazarusidestrconsts:lisnotimplementedyet2 msgid "Not implemented yet." msgstr "Doposud neimplementováno." #: lazarusidestrconsts:lisdeleteallselectedbreakpoints msgid "Delete all selected breakpoints?" msgstr "Odebrat všechny vybrané body přerušení?" #: lazarusidestrconsts:lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" msgstr "Smazat bod přerušení na%s\"%s\"řádku %d?" #: lazarusidestrconsts:lisdeleteallbreakpoints msgid "Delete all breakpoints?" msgstr "Smazat všechny body přerušení?" #: lazarusidestrconsts:lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" msgstr "Smazat všechny body přerušení v souboru %s%s%s?" #: lazarusidestrconsts:lisbreak msgid "Break" msgstr "Přerušit" #: lazarusidestrconsts:lisenablegroup msgid "Enable Group" msgstr "Povolit skupinu" #: lazarusidestrconsts:lisdisablegroup msgid "Disable Group" msgstr "Zakáza skupinu" #: lazarusidestrconsts:lisdisabled msgid "Disabled" msgstr "Zakázáno" #: lazarusidestrconsts:lisinvalidoff msgid "Invalid (Off)" msgstr "Neplatný (Vypnuto)" #: lazarusidestrconsts:lisinvalidon msgid "Invalid (On)" msgstr "Neplatný (Zapnuto)" #: lazarusidestrconsts:lisoff msgid "? (Off)" msgstr "? (Vypnuto)" #: lazarusidestrconsts:lison msgid "? (On)" msgstr "? (Zapnuto)" #: lazarusidestrconsts:lisshrinktosmal msgid "Shrink to smallest" msgstr "Zužit na nejmenší" #: lazarusidestrconsts:lisgrowtolarges msgid "Grow to Largest" msgstr "Narůst na největší" #: lazarusidestrconsts:liswatchpropert msgid "Watch Properties" msgstr "Vlastnosti sledování" #: lazarusidestrconsts:lisexpression msgid "Expression:" msgstr "Výraz:" #: lazarusidestrconsts:lisrepeatcount msgid "Repeat Count:" msgstr "Počet opakování:" #: lazarusidestrconsts:lisdigits msgid "Digits:" msgstr "Cifry:" #: lazarusidestrconsts:lisallowfunctio msgid "Allow Function Calls" msgstr "Povolit volání funkcí" #: lazarusidestrconsts:lisstyle msgid "Style" msgstr "Styl" #: lazarusidestrconsts:lischaracter msgid "Character" msgstr "Znak" #: lazarusidestrconsts:lisstring msgid "String" msgstr "Řetězec" #: lazarusidestrconsts:lisdecimal msgid "Decimal" msgstr "Číselný" #: lazarusidestrconsts:lishexadecimal msgid "Hexadecimal" msgstr "Šestnáctkový" #: lazarusidestrconsts:lisfloatingpoin msgid "Floating Point" msgstr "Plovoucí čárka" #: lazarusidestrconsts:lispointer msgid "Pointer" msgstr "Ukazatel" #: lazarusidestrconsts:lisrecordstruct msgid "Record/Structure" msgstr "Záznam/Struktura" #: lazarusidestrconsts:lismemorydump msgid "Memory Dump" msgstr "Výpis paměti" #: lazarusidestrconsts:lislocals msgid "Locals" msgstr "Místní" #: lazarusidestrconsts:lislocalsdlgname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts:lislocalsdlgvalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts:liseteditcustomscanners msgid "Edit custom scanners (%s)" msgstr "Upravit vlastní prohledávače (%s)" #: lazarusidestrconsts:lispwnewproject msgid "New Project" msgstr "Nový projekt" #: lazarusidestrconsts:lispwopenproject msgid "Open Project" msgstr "Otevřít projekt" #: lazarusidestrconsts:lispwconvertproject msgid "Convert Delphi Project" msgstr "Převést Delphi projekt" #: lazarusidestrconsts:lisinvalidcircle msgid "Invalid circle" msgstr "Neplatný kruh" #: lazarusidestrconsts:lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." msgstr "%s je %s.%sTakováto cyklická závislost není povolená." #: lazarusidestrconsts:listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." msgstr "Komponenta %s nemůže být smazána, protože není vlastněna %s." #: lazarusidestrconsts:lisfilter2 msgid "(filter)" msgstr "(filtr)" #: lazarusidestrconsts:lisfindkeycombination msgid "Find key combination" msgstr "Najít kombinaci kláves" #: lazarusidestrconsts:lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "" #: lazarusidestrconsts:lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." msgstr "" #: lazarusidestrconsts:liscleardirectory msgid "Clear Directory?" msgstr "Vyprázdnit adresář?" #: lazarusidestrconsts:lisinordertocreateacleancopyoftheprojectpackageallfil msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" msgstr "" #: lazarusidestrconsts:lisfileextensionofprograms msgid "File extension of programs" msgstr "Přípona souboru programu" #: lazarusidestrconsts:liseverynthlinenumber msgid "Every n-th line number:" msgstr "Každé n-té číslo řádku:" #: lazarusidestrconsts:lislink msgid "Link:" msgstr "Odkaz:" #: lazarusidestrconsts:lisshort msgid "Short:" msgstr "Krátky:" #: lazarusidestrconsts:lisdeleteoldfile2 msgid "Delete old file?" msgstr "Smazat starý soubor?" #: lazarusidestrconsts:listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" msgstr "" #: lazarusidestrconsts:lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "Verze FPC (např. 2.2.2)" #: lazarusidestrconsts:lismissingidentifiers msgid "Missing identifiers" msgstr "Chybějící identifikátory" #: lazarusidestrconsts:lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "Vyberte odkaz FPDoc" #: lazarusidestrconsts:lislinktarget msgid "Link target" msgstr "" #: lazarusidestrconsts:lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "Příklady:%sIdentifikátor%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" #: lazarusidestrconsts:listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "Název (nechejte prázdné pro výchozí)" #: lazarusidestrconsts:lissyntaxmode msgid "Syntax mode" msgstr "Režim sysntaxe" #: lazarusidestrconsts:lisobjectpascaldefault msgid "Object Pascal - default" msgstr "Object Pascal - výchozí" #: lazarusidestrconsts:lisdelphi msgid "Delphi" msgstr "Delphi" #: lazarusidestrconsts:listurbopascal msgid "Turbo Pascal" msgstr "Turbo Pascal" #: lazarusidestrconsts:lismacpascal msgid "Mac Pascal" msgstr "Mac Pascal" #: lazarusidestrconsts:lisfreepascal msgid "Free Pascal" msgstr "Free Pascal" #: lazarusidestrconsts:lissmallerratherthanfaster msgid "smaller rather than faster" msgstr "menší raději než rychlejší" #: lazarusidestrconsts:lisverifymethodcalls msgid "Verify method calls" msgstr "Ověřeit volání metod" #: lazarusidestrconsts:listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" msgstr "Přepnout zobrazení názvů souborů s plnou cestou nebo s relativní cestou" #: lazarusidestrconsts:lisdeleteselectedfiles msgid "Delete selected files" msgstr "Smazat vybrané soubory" #: lazarusidestrconsts:lisadddirectory msgid "Add directory" msgstr "Přidat adresář" #: lazarusidestrconsts:lisaddfilesofdirectory msgid "Add files of directory" msgstr "Přidat soubory nebo z adresáře" #: lazarusidestrconsts:lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr "" #: lazarusidestrconsts:lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr ""