msgid "" msgstr "" "Project-Id-Version: \n" "POT-Creation-Date: \n" "PO-Revision-Date: 2009-01-07 19:03+0100\n" "Last-Translator: Chronos \n" "Translation-Source: http://tv.zdechov.net/svn/lazarus_czech/\n" "Language-Team: \n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "X-Poedit-Language: Czech\n" #: lazarusidestrconsts.dlg1up2low msgid "Lowercase, first letter up" msgstr "Malé písmena, první písmeno velké" #: lazarusidestrconsts.dlgaddassignmentoperator msgid "Add assignment operator :=" msgstr "Přidat operátor přiřazení :=" #: lazarusidestrconsts.dlgadditionalsrcpath msgid "Additional Source search path for all projects (.pp;.pas)" msgstr "Doplňující zdrojové prohledávácí cesty pro všechny projekty(.pp;.pas)" #: lazarusidestrconsts.dlgaddsemicolon msgid "Add semicolon" msgstr "Přidat středník" #: lazarusidestrconsts.dlgadjusttopline msgid "Adjust top line due to comment in front" msgstr "Přizpůsobit vrchní linku kvůli komentářú vpředu" #: lazarusidestrconsts.dlgallfiles msgid "All files" msgstr "Všechny soubory" #: lazarusidestrconsts.dlgalphabetically msgid "Alphabetically" msgstr "Abecedně" #: lazarusidestrconsts.dlgalwaysvisiblecursor msgid "Always visible cursor" msgstr "Kurzor vždy viditelný" #: lazarusidestrconsts.dlgambigfileact msgid "Ambiguous file action:" msgstr "Nejednoznačná akce souboru:" #: lazarusidestrconsts.dlgambigwarn msgid "Warn on compile" msgstr "Varování při překládání" #: lazarusidestrconsts.dlgapplicationsettings msgid "Application Settings" msgstr "Nastavení aplikace" #: lazarusidestrconsts.dlgassemblerdefault msgid "Default" msgstr "Výchozí" #: lazarusidestrconsts.dlgassertcode msgid "Include Assertion Code" msgstr "Zahrnout kontrolní kód" #: lazarusidestrconsts.dlgautocreateforms msgid "Auto-create forms:" msgstr "Automaticky vytvořené formuláře:" #: lazarusidestrconsts.dlgautocreatenewforms msgid "When creating new forms, add them to auto-created forms" msgstr "Při vytváření nových forem je přidej do automaticky vytvářených forem." #: lazarusidestrconsts.dlgautodel msgid "Auto delete file" msgstr "Automaticky smazat soubor" #: lazarusidestrconsts.dlgautoform msgid "Auto create form when opening unit" msgstr "Automaticky vytvořit formulář při otevření jednotky" #: lazarusidestrconsts.dlgautoindent msgid "Auto indent" msgstr "Automatické odsazení" #: lazarusidestrconsts.dlgautoremoveemptymethods msgid "Auto remove empty methods" msgstr "" #: lazarusidestrconsts.dlgautoren msgid "Auto rename file lowercase" msgstr "Automaticky nastav malá písmena v názvu souboru" #: lazarusidestrconsts.dlgautosave msgid "Auto save" msgstr "Automaticky ukládat" #: lazarusidestrconsts.dlgavailableforms msgid "Available forms:" msgstr "Dostupné formuláře:" #: lazarusidestrconsts.dlgbackcolor msgid "Background" msgstr "Pozadí" #: lazarusidestrconsts.dlgbaknosubdirectory msgid "(no subdirectory)" msgstr "(podadresáře ne)" #: lazarusidestrconsts.dlgbckupsubdir msgid "Same name (in subdirectory)" msgstr "Stejné jméno (v podadresáři)" #: lazarusidestrconsts.dlgbehindmethods msgid "Behind methods" msgstr "Za metodami" #: lazarusidestrconsts.dlgblockindent msgid "Block indent" msgstr "Odsazení bloku" #: lazarusidestrconsts.dlgblockindenttype msgid "Indent method" msgstr "" #: lazarusidestrconsts.dlgblockindenttypecopy msgid "Space/tab as prev Line" msgstr "" #: lazarusidestrconsts.dlgblockindenttypepos msgid "Position only" msgstr "" #: lazarusidestrconsts.dlgblockindenttypespace msgid "Spaces" msgstr "" #: lazarusidestrconsts.dlgbp7cptb msgid "TP/BP 7.0 Compatible" msgstr "Kompatibilní s TP/BP 7.0" #: lazarusidestrconsts.dlgbrackethighlight msgid "Bracket highlight" msgstr "Zvýraznění závorky" #: lazarusidestrconsts.dlgbrowsemsgfilter msgid "Free Pascal Compiler messages file (*.msg)|*.msg|Any Files (*.*)|*.*" msgstr "" #: lazarusidestrconsts.dlgbutapply msgid "Apply" msgstr "Použít" #: lazarusidestrconsts.dlgcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts.dlgcasesensitive msgid "&Case Sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts.dlgccocaption msgid "Checking compiler options" msgstr "Kontrolování voleb překladače" #: lazarusidestrconsts.dlgccoresults msgid "Results" msgstr "Výsledky" #: lazarusidestrconsts.dlgccotest msgid "Test" msgstr "Test" #: lazarusidestrconsts.dlgccotestcheckingcompiler msgid "Test: Checking compiler ..." msgstr "Test: Kontrola překladače..." #: lazarusidestrconsts.dlgccotestcheckingcompilerconfig msgid "Test: Checking compiler configuration ..." msgstr "Test: Kontrola nastavení překladače..." #: lazarusidestrconsts.dlgccotestcheckingfpcconfigs msgid "Test: Checking fpc configs ..." msgstr "Test: Kontrola nastavení fpc..." #: lazarusidestrconsts.dlgccotestcompilerdate msgid "Test: Checking compiler date ..." msgstr "Test: Kontrola datumu překladače..." #: lazarusidestrconsts.dlgccotestcompilingemptyfile msgid "Test: Compiling an empty file ..." msgstr "Test: Překládání prázdného souboru..." #: lazarusidestrconsts.dlgccotestmissingppu msgid "Test: Checking missing fpc ppu ..." msgstr "Test: Kontrola chybějících fpc ppu..." #: lazarusidestrconsts.dlgccotestsrcinppupaths msgid "Test: Checking sources in fpc ppu search paths ..." msgstr "Test: Kontrola zdrojových souborů ve vyhledávacích cestách fpc..." #: lazarusidestrconsts.dlgccotesttoolcompilingemptyfile msgid "Test: Compiling an empty file" msgstr "Test: Překládání prázdného souboru." #: lazarusidestrconsts.dlgcdtclassorder msgid "Class order" msgstr "Pořadí tříd" #: lazarusidestrconsts.dlgcdtlast msgid "Last" msgstr "Poslední" #: lazarusidestrconsts.dlgcdtlower msgid "lowercase" msgstr "malá psímena" #: lazarusidestrconsts.dlgcdtpreview msgid "Preview (Max line length = 1)" msgstr "Náhled (max. délka řádku = 1)" #: lazarusidestrconsts.dlgcdtreadprefix msgid "Read prefix" msgstr "Číst prefix" #: lazarusidestrconsts.dlgcdtstoredpostfix msgid "Stored postfix" msgstr "Uložený prefix" #: lazarusidestrconsts.dlgcdtuppercase msgid "UPPERCASE" msgstr "VELKÁ PÍSMENA" #: lazarusidestrconsts.dlgcdtvariableprefix msgid "Variable prefix" msgstr "Prefix proměnné" #: lazarusidestrconsts.dlgcdtwriteprefix msgid "Write prefix" msgstr "Prefix zápisu" #: lazarusidestrconsts.dlgcentercursorline msgid "Center Cursor Line" msgstr "Vystředit řádek ukazatele" #: lazarusidestrconsts.dlgcharcasefileact msgid "Save As - auto rename pascal files lower case" msgstr "Uložit jako - automaticky přejmenovat pascalovské soubory na malé znaky" #: lazarusidestrconsts.dlgcheckconsistency msgid "Check consistency" msgstr "Zkontrolovat konzistenci" #: lazarusidestrconsts.dlgchscodetempl msgid "Choose code template file (*.dci)" msgstr "Vyberte šablonu kódu (*.dci)" #: lazarusidestrconsts.dlgclassinsertpolicy msgid "Class part insert policy" msgstr "Politika vkládání části tříd" #: lazarusidestrconsts.dlgclosebuttonsnotebook msgid "Show close buttons in notebook" msgstr "Ukázat tlačítka pro zavření v zápisníku" #: lazarusidestrconsts.dlgclrscheme msgid "Color Scheme" msgstr "Barevné schéma" #: lazarusidestrconsts.dlgcmacro msgid "C Style Macros (global)" msgstr "Makra ve stylu C (globální)" #: lazarusidestrconsts.dlgcoansistr msgid "Use Ansi Strings" msgstr "Použít Ansi řetězce" #: lazarusidestrconsts.dlgcoasis msgid "As-Is" msgstr "As-Is" #: lazarusidestrconsts.dlgcoasmstyle msgid "Assembler style:" msgstr "Styl assembleru:" #: lazarusidestrconsts.dlgcocfgcmpmessages msgid "Messages" msgstr "" #: lazarusidestrconsts.dlgcochecks msgid "Checks:" msgstr "Kontroly:" #: lazarusidestrconsts.dlgcocompilation msgid "Compilation" msgstr "Sestavení" #: lazarusidestrconsts.dlgcoconditionals msgid "Conditionals" msgstr "" #: lazarusidestrconsts.dlgcocops msgid "C Style Operators (*=, +=, /= and -=)" msgstr "Operátory ve stylu C (*=, +=, /= and -=)" #: lazarusidestrconsts.dlgcocreatechildnode msgid "Create child node" msgstr "" #: lazarusidestrconsts.dlgcocreatemakefile msgid "Create Makefile" msgstr "Vytvořit Makefile" #: lazarusidestrconsts.dlgcocreatenodeabove msgid "Create node above" msgstr "" #: lazarusidestrconsts.dlgcocreatenodebelow msgid "Create node below" msgstr "" #: lazarusidestrconsts.dlgcodbx msgid "Generate Debugging Info For DBX (Slows Compiling)" msgstr "Generovat ladící informace pro DBX (pomalé překládání)" #: lazarusidestrconsts.dlgcodebugging msgid "Debugging:" msgstr "Ladění:" #: lazarusidestrconsts.dlgcodebugpath msgid "Debugger path addition (none):" msgstr "Přidavná cesta ladícího nástroje (žádná):" #: lazarusidestrconsts.dlgcodecreation msgid "Code Creation" msgstr "Vytvoření kódu" #: lazarusidestrconsts.dlgcodefoldingmouse msgid "Mouse" msgstr "" #: lazarusidestrconsts.dlgcodegeneration msgid "Code" msgstr "Kód" #: lazarusidestrconsts.dlgcodetoolsopts msgid "CodeTools Options" msgstr "Nastavení CodeTools" #: lazarusidestrconsts.dlgcofast msgid "Faster Code" msgstr "Rychlejší kód" #: lazarusidestrconsts.dlgcogdb msgid "Generate Debugging Info For GDB (Slows Compiling)" msgstr "Vytvářet ladící informace pro GDB (pomalé překládání)" #: lazarusidestrconsts.dlgcogenerate msgid "Generate:" msgstr "Generovat:" #: lazarusidestrconsts.dlgcoheaptrc msgid "Use Heaptrc Unit" msgstr "Použít jednotku Heaptrc" #: lazarusidestrconsts.dlgcoincfiles msgid "Include Files (-Fi):" msgstr "Zahrnout soubory (-Fi):" #: lazarusidestrconsts.dlgcoinherited msgid "Inherited" msgstr "Sděděný" #: lazarusidestrconsts.dlgcokeepvarsreg msgid "Keep certain variables in registers" msgstr "Udržovat některé proměnné v registrech" #: lazarusidestrconsts.dlgcolibraries msgid "Libraries (-Fl):" msgstr "Knihovny (-Fl):" #: lazarusidestrconsts.dlgcolinking msgid "Linking" msgstr "Spojování" #: lazarusidestrconsts.dlgcoloadsave msgid "Load/Save" msgstr "Načíst/Uložit" #: lazarusidestrconsts.dlgcolor msgid "Color" msgstr "" #: lazarusidestrconsts.dlgcommandlineparameters msgid "Command line parameters" msgstr "Parametry příkazové řádky" #: lazarusidestrconsts.dlgcommandlineparams msgid "Command line parameters (without application name)" msgstr "Parametry příkazové řádky (bez jména aplikace)" #: lazarusidestrconsts.dlgcomovedown msgid "Move down" msgstr "" #: lazarusidestrconsts.dlgcomoveleveldown msgid "Move level down" msgstr "" #: lazarusidestrconsts.dlgcomovelevelup msgid "Move level up" msgstr "" #: lazarusidestrconsts.dlgcomoveup msgid "Move up" msgstr "" #: lazarusidestrconsts.dlgcompilermessage msgid "Compiler Messages" msgstr "" #: lazarusidestrconsts.dlgcompileroptions msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts.dlgcompleteproperties msgid "Complete properties" msgstr "Vlastnosti dokončení" #: lazarusidestrconsts.dlgconfigfiles msgid "Config Files:" msgstr "Konfigurační soubory:" #: lazarusidestrconsts.dlgconormal msgid "Normal Code" msgstr "Obyčejný kód" #: lazarusidestrconsts.dlgcoopts msgid "Options: " msgstr "Nastavení:" #: lazarusidestrconsts.dlgcoother msgid "Other" msgstr "Jiné" #: lazarusidestrconsts.dlgcooverflow msgid "Overflow" msgstr "Přetečení" #: lazarusidestrconsts.dlgcoparsing msgid "Parsing" msgstr "Analyzování" #: lazarusidestrconsts.dlgcopywordatcursoroncopynone msgid "Copy word on copy none" msgstr "Kopírovat slovo při kopírování žádného" #: lazarusidestrconsts.dlgcorange msgid "Range" msgstr "Rozsah" #: lazarusidestrconsts.dlgcoshowerr msgid "Show Errors" msgstr "Ukázat chyby" #: lazarusidestrconsts.dlgcoshowoptions msgid "&Show Options" msgstr "" #: lazarusidestrconsts.dlgcosmaller msgid "Smaller Code" msgstr "Menší kód" #: lazarusidestrconsts.dlgcosmartlinkable msgid "Smart Linkable" msgstr "Chytré spojování" #: lazarusidestrconsts.dlgcosources msgid "Other Sources (.pp/.pas files, used only by IDE not by compiler)" msgstr "Jiné zdroje (soubory .pp/.pas, použitou pouze IDE ne překladačem)" #: lazarusidestrconsts.dlgcostack msgid "Stack" msgstr "Zásobník" #: lazarusidestrconsts.dlgcostrip msgid "Strip Symbols From Executable" msgstr "Odstranit symboly ze spustitelného" #: lazarusidestrconsts.dlgcounitstyle msgid "Unit Style:" msgstr "Styl jednotky:" #: lazarusidestrconsts.dlgcovalgrind msgid "Generate code for valgrind" msgstr "Vytvářet kód pro valgrind" #: lazarusidestrconsts.dlgcoverbosity msgid "Verbosity" msgstr "" #: lazarusidestrconsts.dlgcppinline msgid "C++ Styled INLINE" msgstr "INLINE ve stylu C++" #: lazarusidestrconsts.dlgcursorbeyondeol msgid "Cursor beyond EOL" msgstr "Ukazatel za koncem řádku" #: lazarusidestrconsts.dlgcursorgroupoptions msgid "Cursor:" msgstr "" #: lazarusidestrconsts.dlgcursorskipsselection msgid "Cursor skips selection" msgstr "Kurzor přeskakuje výběr" #: lazarusidestrconsts.dlgcustomext msgid "User defined extension (.pp.xxx)" msgstr "Uživatelsky definované rozšíření (.pp.xxx)" #: lazarusidestrconsts.dlgdebugoptionspatheditordlgcaption msgid "Path Editor" msgstr "Editor cest" #: lazarusidestrconsts.dlgdebugtype msgid "Debugger type and path" msgstr "Typ a cesta ladiče" #: lazarusidestrconsts.dlgdefaulteditorfont msgid "Default editor font" msgstr "Výchozí písmo editoru" #: lazarusidestrconsts.dlgdefvaluecolor msgid "Default Value" msgstr "Výchozí hodnota" #: lazarusidestrconsts.dlgdelphi2ext msgid "Delphi 2 Extensions" msgstr "Rozšíření Delphi 2" #: lazarusidestrconsts.dlgdeltemplate msgid "Delete template " msgstr "Odstranit šablonu" #: lazarusidestrconsts.dlgdeplhicomp msgid "Delphi Compatible" msgstr "Kompatibilní s Delphi" #: lazarusidestrconsts.dlgdesktop msgid "Desktop" msgstr "Plocha" #: lazarusidestrconsts.dlgdesktopbuttons msgid "Buttons - " msgstr "" #: lazarusidestrconsts.dlgdesktopfiles msgid "Desktop files" msgstr "Soubory na ploše" #: lazarusidestrconsts.dlgdesktopglyphsfor msgid "Glyphs for:" msgstr "" #: lazarusidestrconsts.dlgdesktophints msgid "Hints" msgstr "" #: lazarusidestrconsts.dlgdesktopmenus msgid "Menus - " msgstr "" #: lazarusidestrconsts.dlgdesktopmisc msgid "Misc Options" msgstr "" #: lazarusidestrconsts.dlgdirection msgid "Direction" msgstr "Směr" #: lazarusidestrconsts.dlgdirectorydoesnotexist msgid "Directory does not exist" msgstr "Složka neexistuje" #: lazarusidestrconsts.dlgdisableantialiasing msgid "Disable anti-aliasing" msgstr "Zakázat vyhlazování grafiky" #: lazarusidestrconsts.dlgdividerdrawdepth msgid "Draw divider level" msgstr "" #: lazarusidestrconsts.dlgdividernestcolor msgid "Nested line color" msgstr "" #: lazarusidestrconsts.dlgdividernestcolordefault msgid "Use Default" msgstr "" #: lazarusidestrconsts.dlgdivideronoff msgid "Draw divider" msgstr "" #: lazarusidestrconsts.dlgdividertopcolor msgid "Line color" msgstr "" #: lazarusidestrconsts.dlgdividertopcolordefault msgid "Use Default" msgstr "" #: lazarusidestrconsts.dlgdivpasbeginendname msgid "Begin/End" msgstr "" #: lazarusidestrconsts.dlgdivpasprocedurename msgid "Procedure/Function" msgstr "" #: lazarusidestrconsts.dlgdivpasstructglobalname msgid "Class/Struct" msgstr "" #: lazarusidestrconsts.dlgdivpasstructlocalname msgid "Class/Struct (local)" msgstr "" #: lazarusidestrconsts.dlgdivpastryname msgid "Try/Except" msgstr "" #: lazarusidestrconsts.dlgdivpasunitsectionname msgid "Unit sections" msgstr "" #: lazarusidestrconsts.dlgdivpasusesname msgid "Uses clause" msgstr "" #: lazarusidestrconsts.dlgdivpasvarglobalname msgid "Var/Type" msgstr "" #: lazarusidestrconsts.dlgdivpasvarlocalname msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgdoesnotexist msgid "\" does not exist." msgstr "\" neexistuje." #: lazarusidestrconsts.dlgdownword msgid "Down" msgstr "Dolů" #: lazarusidestrconsts.dlgdropfiles msgid "Drop files" msgstr "Umístit soubory" #: lazarusidestrconsts.dlgedadd msgid "Add..." msgstr "Přidat..." #: lazarusidestrconsts.dlgedback msgid "Back" msgstr "Zpět" #: lazarusidestrconsts.dlgedbold msgid "Bold" msgstr "Tučné" #: lazarusidestrconsts.dlgedbsubdir msgid "Sub directory" msgstr "Podadresář" #: lazarusidestrconsts.dlgedcodetempl msgid "Code templates" msgstr "Šablony kódu" #: lazarusidestrconsts.dlgedcolor msgid "Colors" msgstr "" #: lazarusidestrconsts.dlgedcompleteblocks msgid "Complete blocks" msgstr "" #: lazarusidestrconsts.dlgedcustomext msgid "User defined extension" msgstr "Uživatelsky definované rozšíření" #: lazarusidestrconsts.dlgeddelay msgid "Delay" msgstr "Prodleva" #: lazarusidestrconsts.dlgeddelete msgid "Delete" msgstr "Odstranit" #: lazarusidestrconsts.dlgeddisplay msgid "Display" msgstr "Zobrazení" #: lazarusidestrconsts.dlgededit msgid "Edit..." msgstr "Upravit..." #: lazarusidestrconsts.dlgedfiles msgid "Editor files" msgstr "Soubory editoru" #: lazarusidestrconsts.dlgedhintcommand msgid "Hint: click on the command you want to edit" msgstr "Pokyn: Klikněte na příkaz, který chcete editovat" #: lazarusidestrconsts.dlgedidcomlet msgid "Identifier completion" msgstr "Dokončení identifikátoru" #: lazarusidestrconsts.dlgedinvert msgid "Invert" msgstr "Převrácené" #: lazarusidestrconsts.dlgedital msgid "Italic" msgstr "Kurzíva" #: lazarusidestrconsts.dlgeditorfont msgid "Editor font" msgstr "Písmo editoru" #: lazarusidestrconsts.dlgeditorfontheight msgid "Editor font height" msgstr "Výška písma editoru" #: lazarusidestrconsts.dlgedmisc msgid "Misc" msgstr "Různé" #: lazarusidestrconsts.dlgednoerr msgid "No errors in key mapping found." msgstr "V mapování kláves nebyla nalezena žádná chyba." #: lazarusidestrconsts.dlgedoff msgid "Off" msgstr "Vypnuto" #: lazarusidestrconsts.dlgedon msgid "On" msgstr "Zapnuto" #: lazarusidestrconsts.dlgedunder msgid "Underline" msgstr "Podtržené" #: lazarusidestrconsts.dlgedusedefcolor msgid "Use default color" msgstr "Použít výchozí barvu" #: lazarusidestrconsts.dlgelementattributes msgid "Element Attributes" msgstr "Vlastnosti prvku" #: lazarusidestrconsts.dlgendkeyjumpstoneareststart msgid "End key jumps to nearest end" msgstr "" #: lazarusidestrconsts.dlgentirescope msgid "&Entire Scope" msgstr "&Celkový rozsah" #: lazarusidestrconsts.dlgenvask msgid "Ask" msgstr "Zeptat" #: lazarusidestrconsts.dlgenvbackuphelpnote msgid "Notes: Project files are all files in the project directory" msgstr "Poznámky: Soubory projektu jsou všechny soubory v adresáři projektu" #: lazarusidestrconsts.dlgenvbckup msgid "Backup" msgstr "Záloha" #: lazarusidestrconsts.dlgenvcolors msgid "Colors" msgstr "Barvy" #: lazarusidestrconsts.dlgenvfiles msgid "Files" msgstr "Soubory" #: lazarusidestrconsts.dlgenvgrid msgid "Grid" msgstr "Mřížka" #: lazarusidestrconsts.dlgenvlanguage msgid "Language" msgstr "Jazyk" #: lazarusidestrconsts.dlgenvlguidelines msgid "Guide lines" msgstr "Vodící čáry" #: lazarusidestrconsts.dlgenvmisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts.dlgenvnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts.dlgenvotherfiles msgid "Other files" msgstr "Jiné soubory" #: lazarusidestrconsts.dlgenvproject msgid "Project" msgstr "Projekt" #: lazarusidestrconsts.dlgenvtype msgid "Type" msgstr "Typ" #: lazarusidestrconsts.dlgeofocusmessagesaftercompilation msgid "Focus messages after compilation" msgstr "Po překladu zaměřit okno zpráv" #: lazarusidestrconsts.dlgextracharspacing msgid "Extra char spacing" msgstr "Dodatečné mezery znaku" #: lazarusidestrconsts.dlgextralinespacing msgid "Extra line spacing" msgstr "Dodatečné mezery řádku" #: lazarusidestrconsts.dlgextsymb msgid "Use external gdb debug symbols file" msgstr "Používat externí soubor ladících symbolů GDB." #: lazarusidestrconsts.dlgfileexts msgid "File extensions" msgstr "Přípony souboru" #: lazarusidestrconsts.dlgfindtextatcursor msgid "Find text at cursor" msgstr "Najít text od kurzoru" #: lazarusidestrconsts.dlgfoldlocalpasvartype msgid "Var/Type (local)" msgstr "" #: lazarusidestrconsts.dlgfoldpasasm msgid "Asm" msgstr "" #: lazarusidestrconsts.dlgfoldpasbeginend msgid "Begin/End (nested)" msgstr "" #: lazarusidestrconsts.dlgfoldpascase msgid "Case" msgstr "" #: lazarusidestrconsts.dlgfoldpasclass msgid "Class/Object" msgstr "" #: lazarusidestrconsts.dlgfoldpasclasssection msgid "public/private" msgstr "" #: lazarusidestrconsts.dlgfoldpasexcept msgid "Except/Finally" msgstr "" #: lazarusidestrconsts.dlgfoldpasifdef msgid "{$IfDef}" msgstr "" #: lazarusidestrconsts.dlgfoldpasnestedcomment msgid "Nested Comment" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocbeginend msgid "Begin/End (procedure)" msgstr "" #: lazarusidestrconsts.dlgfoldpasprocedure msgid "Procedure" msgstr "" #: lazarusidestrconsts.dlgfoldpasprogram msgid "Program" msgstr "" #: lazarusidestrconsts.dlgfoldpasrecord msgid "Record" msgstr "" #: lazarusidestrconsts.dlgfoldpasrepeat msgid "Repeat" msgstr "" #: lazarusidestrconsts.dlgfoldpastry msgid "Try" msgstr "" #: lazarusidestrconsts.dlgfoldpasunit msgid "Unit" msgstr "" #: lazarusidestrconsts.dlgfoldpasunitsection msgid "Unit section" msgstr "" #: lazarusidestrconsts.dlgfoldpasuserregion msgid "{%Region}" msgstr "" #: lazarusidestrconsts.dlgfoldpasuses msgid "Uses" msgstr "" #: lazarusidestrconsts.dlgfoldpasvartype msgid "Var/Type (global)" msgstr "" #: lazarusidestrconsts.dlgforecolor msgid "Foreground" msgstr "Popředí" #: lazarusidestrconsts.dlgforwardprocsinsertpolicy msgid "Procedure insert policy" msgstr "Politika vkládání procedůr" #: lazarusidestrconsts.dlgforwardprocskeeporder msgid "Keep order of procedures" msgstr "Udržovat pořadí procedůr" #: lazarusidestrconsts.dlgfpcpath msgid "Compiler path (e.g. %s)" msgstr "Cesta překladače (např. %s)" #: lazarusidestrconsts.dlgfpcsrcpath msgid "FPC source directory" msgstr "Zdrojový adresář FPC" #: lazarusidestrconsts.dlgframecolor msgid "Frame color" msgstr "Barva rámečku" #: lazarusidestrconsts.dlgfrmeditor msgid "Form Editor" msgstr "Editor formuláře" #: lazarusidestrconsts.dlgfromcursor msgid "&From Cursor" msgstr "&Od kurzoru" #: lazarusidestrconsts.dlgfropts msgid "Options" msgstr "Nastavení" #: lazarusidestrconsts.dlggeneratedwarf msgid "Generate dwarf debug information" msgstr "" #: lazarusidestrconsts.dlggetposition msgid "Get position" msgstr "Získat pozici" #: lazarusidestrconsts.dlgglobal msgid "&Global" msgstr "&Celkový" #: lazarusidestrconsts.dlgglyphshowalways msgid "Show Always" msgstr "" #: lazarusidestrconsts.dlgglyphshownever msgid "Show Never" msgstr "" #: lazarusidestrconsts.dlgglyphshowsystem msgid "Use System Defaults" msgstr "" #: lazarusidestrconsts.dlggpccomp msgid "GPC (GNU Pascal Compiler) Compatible" msgstr "Kompatibilní s GPC (GNU Pascal Compiler)" #: lazarusidestrconsts.dlggprof msgid "Generate code for gprof" msgstr "Vytvářet kód pro gprof" #: lazarusidestrconsts.dlggrabbercolor msgid "Grabber color" msgstr "Barva zachytávače" #: lazarusidestrconsts.dlggridcolor msgid "Grid color" msgstr "Barva mřížky" #: lazarusidestrconsts.dlggridx msgid "Grid size X" msgstr "Rozměr mřížky X" #: lazarusidestrconsts.dlggridxhint msgid "Horizontal grid step size" msgstr "Velikost horizontálního kroku mřížky" #: lazarusidestrconsts.dlggridy msgid "Grid size Y" msgstr "Rozměr mřížky Y" #: lazarusidestrconsts.dlggridyhint msgid "Vertical grid step size" msgstr "Velikost svislého kroku mřížky" #: lazarusidestrconsts.dlggroupcodeexplorer msgid "Code Explorer" msgstr "" #: lazarusidestrconsts.dlggroupcodetools msgid "Codetools" msgstr "Kódové nástroje" #: lazarusidestrconsts.dlggroupdebugger msgid "Debugger" msgstr "" #: lazarusidestrconsts.dlggroupeditor msgid "Editor" msgstr "Editor" #: lazarusidestrconsts.dlggroupenvironment msgid "Environment" msgstr "Prostředí" #: lazarusidestrconsts.dlggrouphelp msgid "Help" msgstr "" #: lazarusidestrconsts.dlggroupundo msgid "Group Undo" msgstr "Vrátit zpět skupinu" #: lazarusidestrconsts.dlgguidelines msgid "Show Guide Lines" msgstr "Ukázat vodící čáry" #: lazarusidestrconsts.dlggutter msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgguttercolor msgid "Gutter Color" msgstr "Barva pomocného sloupce editoru" #: lazarusidestrconsts.dlggutteredgecolor msgid "Gutter Edge Color" msgstr "Barva okraje pomocného sloupce editoru" #: lazarusidestrconsts.dlggutterseparatorindex msgid "Gutter separator index" msgstr "" #: lazarusidestrconsts.dlggutterwidth msgid "Gutter width" msgstr "Šířka pomocného sloupce editoru" #: lazarusidestrconsts.dlghalfpagescroll msgid "Half page scroll" msgstr "Poloviční posouvání stránky" #: lazarusidestrconsts.dlgheapsize msgid "Heap Size" msgstr "Velikost haldy" #: lazarusidestrconsts.dlgheightpos msgid "Height:" msgstr "Výška:" #: lazarusidestrconsts.dlghideideonrun msgid "Hide IDE windows on run" msgstr "Skrýt okna IDE při spuštění" #: lazarusidestrconsts.dlghidemessagesicons msgid "Hide Messages Icons" msgstr "" #: lazarusidestrconsts.dlghighlightcolor msgid "Highlight Color" msgstr "Barva zvýraznění" #: lazarusidestrconsts.dlghighlightfontcolor msgid "Highlight Font Color" msgstr "Barva zvýraznění písma" #: lazarusidestrconsts.dlghighlightleftofcursor msgid "Left Of Cursor" msgstr "Nalevo od kurzoru" #: lazarusidestrconsts.dlghighlightrightofcursor msgid "Right Of Cursor" msgstr "Napravo od kurzoru" #: lazarusidestrconsts.dlghintsparametersendernotused msgid "Show Hints for parameter \"Sender\" not used" msgstr "Zobrazení pokynů pro parameter \"Sender\" nepoužito" #: lazarusidestrconsts.dlghintsunused msgid "Show Hints for unused units in main source" msgstr "Zobrazení pokynů k nepoužitým jednotkám v hlavním zdrojovém kódu" #: lazarusidestrconsts.dlghomekeyjumpstoneareststart msgid "Home key jumps to nearest start" msgstr "Klávesa Home skočí k nejbližšímu startu" #: lazarusidestrconsts.dlghostapplication msgid "Host application" msgstr "Hostitelská aplikace" #: lazarusidestrconsts.dlgidentifiercompletion msgid "Identifier completion" msgstr "Dokončení identifikátoru" #: lazarusidestrconsts.dlgidentifierpolicy msgid "Identifier policy" msgstr "Politika identifikátorů" #: lazarusidestrconsts.dlgignoreverb msgid "Ignore" msgstr "Ignorovat" #: lazarusidestrconsts.dlgincludesystemvariables msgid "Include system variables" msgstr "Zahrnout systémové proměnné" #: lazarusidestrconsts.dlgindentcodeto msgid "Indent code to" msgstr "Odsadit kód na" #: lazarusidestrconsts.dlgindentstabsgroupoptions msgid "Indent and Tabs:" msgstr "" #: lazarusidestrconsts.dlginfrontofmethods msgid "In front of methods" msgstr "Před metodami" #: lazarusidestrconsts.dlginitdoneonly msgid "Constructor name must be 'init' (destructor must be 'done')" msgstr "Jméno konstruktoru musí být 'init' (destruktor musí být 'done')" #: lazarusidestrconsts.dlginsspaceafter msgid "Insert space after" msgstr "Vložit mezeru po" #: lazarusidestrconsts.dlginsspacefront msgid "Insert space in front of" msgstr "Vložit mezeru před" #: lazarusidestrconsts.dlgintvinsec msgid "Interval in secs" msgstr "Interval v sekundách" #: lazarusidestrconsts.dlgjumpingetc msgid "Jumping (e.g. Method Jumping)" msgstr "Skákání (např. metoda skákání)" #: lazarusidestrconsts.dlgkeepcursorx msgid "Keep cursor X position" msgstr "Udržovat x-ovou pozici kurzoru" #: lazarusidestrconsts.dlgkeymapping msgid "Key Mappings" msgstr "Mapování kláves" #: lazarusidestrconsts.dlgkeymappingerrors msgid "Key mapping errors" msgstr "Chyba mapování kláves" #: lazarusidestrconsts.dlgkeymappingscheme msgid "Key Mapping Scheme" msgstr "Schéma mapování kláves" #: lazarusidestrconsts.dlgkeywordpolicy msgid "Keyword policy" msgstr "Politika klíčových slov" #: lazarusidestrconsts.dlglabelgoto msgid "Allow LABEL and GOTO" msgstr "Povolit LABEL a GOTO" #: lazarusidestrconsts.dlglang msgid "Language" msgstr "Jazyk" #: lazarusidestrconsts.dlglast msgid "Last (i.e. at end of source)" msgstr "Poslední (např. na konci zdrojového kódu)" #: lazarusidestrconsts.dlglazarusdir msgid "Lazarus directory (default for all projects)" msgstr "Adresář Lazarusu (výchozí pro všechny projekty)" #: lazarusidestrconsts.dlgleftpos msgid "Left:" msgstr "Vlevo:" #: lazarusidestrconsts.dlglefttopclr msgid "color for left, top" msgstr "barva pro levý horní" #: lazarusidestrconsts.dlglevel1opt msgid "Level 1 (quick and debugger friendly)" msgstr "Úroveň 1 (rychlé a přáteské k ladění)" #: lazarusidestrconsts.dlglevel2opt msgid "Level 2 (Level 1 + quick optimizations)" msgstr "Úroveň 2 (Úroveň 1 + rychlá optimalizace)" #: lazarusidestrconsts.dlglevel3opt msgid "Level 3 (Level 2 + slow optimizations)" msgstr "Úroveň 3 (Úroveň 2 + pomalá optimalizace)" #: lazarusidestrconsts.dlglevelnoneopt msgid "Level 0 (no extra Optimizations)" msgstr "Úroveň 0 (bez zvláštní optimalizace)" #: lazarusidestrconsts.dlglinesplitting msgid "Line Splitting" msgstr "Dělení řádků" #: lazarusidestrconsts.dlglinklibraries msgid "Link Style:" msgstr "Styl spoje:" #: lazarusidestrconsts.dlglinksmart msgid "Link Smart" msgstr "Chytré spojování" #: lazarusidestrconsts.dlglnumsbct msgid "Display Line Numbers in Run-time Error Backtraces" msgstr "Zobrazit čísla řádků v běhových chybách při zpětném sledování" #: lazarusidestrconsts.dlgloaddfile msgid "Load desktop settings from file" msgstr "Načíst nastavení plochy ze souboru" #: lazarusidestrconsts.dlgmainmenu msgid "Main Menu" msgstr "Hlavní menu" #: lazarusidestrconsts.dlgmainviewforms msgid "View project forms" msgstr "Zobrazit formuláře projektu" #: lazarusidestrconsts.dlgmainviewframes msgid "View project frames" msgstr "Zobrazit rámce projektů" #: lazarusidestrconsts.dlgmainviewunits msgid "View project units" msgstr "Zobrazit jednotky projektu" #: lazarusidestrconsts.dlgmakepath msgid "Make path" msgstr "Vytvořit cestu" #: lazarusidestrconsts.dlgmargingutter msgid "Margin and gutter" msgstr "Okraj a pomocný sloupec" #: lazarusidestrconsts.dlgmarkercolor msgid "Marker color" msgstr "Barva značkovače" #: lazarusidestrconsts.dlgmarkupwordfull msgid "Current Word match word boundaries" msgstr "" #: lazarusidestrconsts.dlgmarkupwordfulllen msgid "Only if shorter than" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnokeyword msgid "Ignore Keywords" msgstr "" #: lazarusidestrconsts.dlgmarkupwordnotimer msgid "Disable Timer for Markup Current Word" msgstr "" #: lazarusidestrconsts.dlgmarkupwordtrim msgid "Trim Spaces" msgstr "" #: lazarusidestrconsts.dlgmaxcntr msgid "Maximum counter" msgstr "Maximum čítače" #: lazarusidestrconsts.dlgmaxlinelength msgid "Max line length:" msgstr "Max. délka řádku:" #: lazarusidestrconsts.dlgmaxrecentfiles msgid "Max recent files" msgstr "Maximum nedávných souborů" #: lazarusidestrconsts.dlgmaxrecentprojs msgid "Max recent project files" msgstr "Maximum nedávných souborů projektů" #: lazarusidestrconsts.dlgmethodinspolicy msgid "Method insert policy" msgstr "Způsob vkládání metod" #: lazarusidestrconsts.dlgminimizeallonminimizemain msgid "Minimize all on minimize main" msgstr "Minimalizovat všechno při minimalizování hlavního" #: lazarusidestrconsts.dlgmixmethodsandproperties msgid "Mix methods and properties" msgstr "Slučovat metody a vlastnosti" #: lazarusidestrconsts.dlgmousefoldbutton msgid "Button" msgstr "" #: lazarusidestrconsts.dlgmousefoldbuttonleft msgid "Left" msgstr "" #: lazarusidestrconsts.dlgmousefoldbuttonmiddle msgid "Middle" msgstr "" #: lazarusidestrconsts.dlgmousefoldbuttonright msgid "Right" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolfoldall msgid "Fold All (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolfoldone msgid "Fold One (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolunfoldall msgid "Unfold All (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldcolunfoldone msgid "Unfold One (Some Colapsed)" msgstr "" #: lazarusidestrconsts.dlgmousefoldenabled msgid "Enabled" msgstr "" #: lazarusidestrconsts.dlgmousefoldexpfoldall msgid "Fold All (All Expanded)" msgstr "" #: lazarusidestrconsts.dlgmousefoldexpfoldone msgid "Fold One (All Expanded)" msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup1 msgid "Setting 1" msgstr "" #: lazarusidestrconsts.dlgmousefoldgroup2 msgid "Setting 2" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifieralt msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifierctrl msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmousefoldmodifiershift msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmousegroupoptions msgid "Mouse:" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn1 msgid "Single" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn2 msgid "Double" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn3 msgid "Triple" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtn4 msgid "Quad" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnadd msgid "Add" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnany msgid "Any" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtncancel msgid "Cancel" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtndel msgid "Delete" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtndown msgid "Down" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnexport msgid "Export" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra1 msgid "Extra 1" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnextra2 msgid "Extra 2" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnimport msgid "Import" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnleft msgid "Left" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnmiddle msgid "Middle" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnmoddef msgid "Make Fallback" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnok msgid "Ok" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnright msgid "Right" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnudp msgid "Change" msgstr "" #: lazarusidestrconsts.dlgmouseoptbtnup msgid "Up" msgstr "" #: lazarusidestrconsts.dlgmouseoptcapture msgid "Capture" msgstr "" #: lazarusidestrconsts.dlgmouseoptcaretmove msgid "Move Caret (extra)" msgstr "" #: lazarusidestrconsts.dlgmouseoptcheckupdown msgid "Act on Mouse up" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescaction msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptdescbutton msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptdlgtitle msgid "Edit Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseopterrordup msgid "Duplicate Entry" msgstr "" #: lazarusidestrconsts.dlgmouseopterrorduptext msgid "This entry conflicts with an existing entry" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadalt msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadbtn msgid "Button" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcaret msgid "Caret" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadcount msgid "Click" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadctrl msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmouseoptheaddesc msgid "Action" msgstr "" #: lazarusidestrconsts.dlgmouseoptheaddir msgid "Up/Down" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadopt msgid "Option" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadpriority msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmouseoptheadshift msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmouseoptions msgid "Mouse" msgstr "" #: lazarusidestrconsts.dlgmouseoptionsyncommand msgid "IDE-Command" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodalt msgid "Alt" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodctrl msgid "Ctrl" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyfalse msgid "n" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeyignore msgid "-" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodkeytrue msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptmodshift msgid "Shift" msgstr "" #: lazarusidestrconsts.dlgmouseoptmovemousetrue msgid "Y" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutter msgid "Gutter" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfold msgid "Fold Tree" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldcol msgid "Collapsed [+]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterfoldexp msgid "Expanded [-]" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodegutterlines msgid "Line Numbers" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodemain msgid "Text" msgstr "" #: lazarusidestrconsts.dlgmouseoptnodeselect msgid "Selection" msgstr "" #: lazarusidestrconsts.dlgmouseoptpriorlabel msgid "Priority" msgstr "" #: lazarusidestrconsts.dlgmsgs msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts.dlgmultiselect msgid "Multi Select" msgstr "Vícenásobný výběr" #: lazarusidestrconsts.dlgnaming msgid "Naming" msgstr "Pojmenování" #: lazarusidestrconsts.dlgnoautomaticrenaming msgid "no automatic renaming" msgstr "automatické přejmenovávání ne" #: lazarusidestrconsts.dlgnobrackethighlight msgid "No Highlight" msgstr "Bez zvýrazňování" #: lazarusidestrconsts.dlgnotsplitlineafter msgid "Do not split line after:" msgstr "Nerozdělovat řádek po:" #: lazarusidestrconsts.dlgnotsplitlinefront msgid "Do not split line In front of:" msgstr "Nerozdělovat řádek před:" #: lazarusidestrconsts.dlgobjinsp msgid "Object Inspector" msgstr "Inspektor objektů" #: lazarusidestrconsts.dlgoiitemheight msgid "Item height" msgstr "Výška položky" #: lazarusidestrconsts.dlgoimiscellaneous msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts.dlgoioptions msgid "Options" msgstr "Nastavení" #: lazarusidestrconsts.dlgoispeedsettings msgid "Speed settings" msgstr "Nastavení rychlosti" #: lazarusidestrconsts.dlgoiusedefaultdelphisettings msgid "Use default Delphi settings" msgstr "Použít výchozí nastavení Delphi" #: lazarusidestrconsts.dlgoiusedefaultlazarussettings msgid "Use default Lazarus settings" msgstr "Použít výchozí nastavení Lazarusu" #: lazarusidestrconsts.dlgoptimiz msgid "Optimizations:" msgstr "Optimalizace:" #: lazarusidestrconsts.dlgotherunitfiles msgid "Other Unit Files (-Fu) (Delimiter is semicolon):" msgstr "Jiné soubory jednotek (-Fu) (středník je oddělovač)" #: lazarusidestrconsts.dlgpalhints msgid "Hints for component palette" msgstr "Popisky pro paletu komponent" #: lazarusidestrconsts.dlgpasext msgid "Default pascal extension" msgstr "Výchozí přípona pascalu" #: lazarusidestrconsts.dlgpassoptslinker msgid "Pass Options To The Linker (Delimiter is space)" msgstr "Předat nastavení spojovači (mezera je oddělovač)" #: lazarusidestrconsts.dlgpersistentcursor msgid "Persistent cursor" msgstr "Trvalý ukazatel" #: lazarusidestrconsts.dlgpldpackagegroup msgid "Package group" msgstr "Skupina balíčků" #: lazarusidestrconsts.dlgpoapplication msgid "Application" msgstr "Aplikace" #: lazarusidestrconsts.dlgpoclearicon msgid "Clear Icon" msgstr "Vyčistit ikonu" #: lazarusidestrconsts.dlgpocreateappbundle msgid "Create Application Bundle" msgstr "Vytvořit aplikační balík" #: lazarusidestrconsts.dlgpofroms msgid "Forms" msgstr "Formuláře" #: lazarusidestrconsts.dlgpoi18n msgid "i18n" msgstr "i18n" #: lazarusidestrconsts.dlgpoicon msgid "Icon:" msgstr "Ikona:" #: lazarusidestrconsts.dlgpoicondesc msgid "(size: %d:%d, bpp: %d)" msgstr "(velikost: %d:%d, bpp: %d)" #: lazarusidestrconsts.dlgpoicondescnone msgid "(none)" msgstr "(žádný)" #: lazarusidestrconsts.dlgpoloadicon msgid "Load Icon" msgstr "Načíst ikonu" #: lazarusidestrconsts.dlgpomisc msgid "Miscellaneous" msgstr "Různé" #: lazarusidestrconsts.dlgpooutputsettings msgid "Output Settings" msgstr "Nastavení výstupu" #: lazarusidestrconsts.dlgposaveicon msgid "Save Icon" msgstr "Uložit ikonu" #: lazarusidestrconsts.dlgposavesession msgid "Session" msgstr "Sezení" #: lazarusidestrconsts.dlgpotargetfilename msgid "Target file name:" msgstr "Cílové jméno souboru:" #: lazarusidestrconsts.dlgpotitle msgid "Title:" msgstr "Nadpis:" #: lazarusidestrconsts.dlgpouseappbundle msgid "Use Application Bundle for running and debugging (darwin only)" msgstr "Použít aplikační balík pro spuštění a ladění (pouze darwin)" #: lazarusidestrconsts.dlgpousemanifest msgid "Use manifest file to enable themes (windows only)" msgstr "Použít soubor manifest k povolení grafických stylů (pouze Windows)" #: lazarusidestrconsts.dlgprojectoptions msgid "Project Options" msgstr "Volby projektu" #: lazarusidestrconsts.dlgprojfiles msgid "Project files" msgstr "Soubory projektu" #: lazarusidestrconsts.dlgpromptonreplace msgid "&Prompt On Replace" msgstr "&Dotázat se při nahrazení" #: lazarusidestrconsts.dlgpropertycompletion msgid "Property completion" msgstr "Dokončení vlastnosti" #: lazarusidestrconsts.dlgpropnamecolor msgid "Property Name" msgstr "Jméno vlastnosti" #: lazarusidestrconsts.dlgqopenlastprj msgid "Open last project at start" msgstr "Otevřít poslední projekt při startu" #: lazarusidestrconsts.dlgqshowborderspacing msgid "Show border spacing" msgstr "Ukázat mezery od okrajů" #: lazarusidestrconsts.dlgqshowcompiledialog msgid "Show compile dialog" msgstr "Zobrazit dialog překladače" #: lazarusidestrconsts.dlgqshowgrid msgid "Show grid" msgstr "Zobrazit mřížku" #: lazarusidestrconsts.dlgqsnaptogrid msgid "Snap to grid" msgstr "Přichytit k mřížce" #: lazarusidestrconsts.dlgreferencecolor msgid "Reference" msgstr "Odkazy" #: lazarusidestrconsts.dlgregularexpressions msgid "&Regular Expressions" msgstr "&Regulární výrazy" #: lazarusidestrconsts.dlgreplaceall msgid "Replace &All" msgstr "Nahradit &vše" #: lazarusidestrconsts.dlgreplacewith msgid "&Replace With" msgstr "&Nahradit s" #: lazarusidestrconsts.dlgreport msgid "Report" msgstr "Hlášení" #: lazarusidestrconsts.dlgrightbottomclr msgid "color for right, bottom" msgstr "" #: lazarusidestrconsts.dlgrightclickselects msgid "Right Click selects" msgstr "" #: lazarusidestrconsts.dlgrightmargin msgid "Right margin" msgstr "Pravý okraj" #: lazarusidestrconsts.dlgroworkingdirectory msgid "Working directory" msgstr "Pracovní složka:" #: lazarusidestrconsts.dlgrubberbandgroup msgid "Rubber band" msgstr "" #: lazarusidestrconsts.dlgrubberbandselectsgrandchilds msgid "Select grand childs" msgstr "" #: lazarusidestrconsts.dlgruberbandcreationcolor msgid "Creation" msgstr "Vytvoření" #: lazarusidestrconsts.dlgruberbandselectioncolor msgid "Selection" msgstr "Výběr" #: lazarusidestrconsts.dlgrunodisplay msgid "Display (not for win32, e.g. 198.112.45.11:0, x.org:1, hydra:0.1)" msgstr "Zobrazení (ne pro win32, např. 198.112.45.11:0, x.org:1, hydra:0.1)" #: lazarusidestrconsts.dlgrunoenvironment msgid "Environment" msgstr "Prostředí" #: lazarusidestrconsts.dlgrunolocal msgid "Local" msgstr "Místní" #: lazarusidestrconsts.dlgrunosystemvariables msgid "System variables" msgstr "Systémové proměnné" #: lazarusidestrconsts.dlgrunousedisplay msgid "Use display" msgstr "Použít zobrazení" #: lazarusidestrconsts.dlgrunouseroverrides msgid "User overrides" msgstr "Uživatelské předefinování" #: lazarusidestrconsts.dlgrunovalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts.dlgrunovariable msgid "Variable" msgstr "Proměnná" #: lazarusidestrconsts.dlgrunparameters msgid "Run parameters" msgstr "Spustit s parametry" #: lazarusidestrconsts.dlgsavedfile msgid "Save desktop settings to file" msgstr "Uložit nastavení plochy do souboru" #: lazarusidestrconsts.dlgsavedlinecolor msgid "Saved line" msgstr "" #: lazarusidestrconsts.dlgsaveeditorinfo msgid "Save editor info for closed files" msgstr "Ukládat informace editoru k zavčených souborech" #: lazarusidestrconsts.dlgsaveeditorinfoproject msgid "Save editor info only for project files" msgstr "Ukládat informace editoru k souborům projektu" #: lazarusidestrconsts.dlgscope msgid "Scope" msgstr "Rozsah" #: lazarusidestrconsts.dlgscrollbyoneless msgid "Scroll by one less" msgstr "Posunout o jedno méně" #: lazarusidestrconsts.dlgscrollgroupoptions msgid "Scrolling:" msgstr "" #: lazarusidestrconsts.dlgscrollpastendfile msgid "Scroll past end of file" msgstr "" #: lazarusidestrconsts.dlgscrollpastendline msgid "Caret past end of line" msgstr "" #: lazarusidestrconsts.dlgseachdirectorynotfound msgid "Search directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.dlgsearchabort msgid "Search terminated by user." msgstr "Hledání přerušeno uživatelem." #: lazarusidestrconsts.dlgsearchcaption msgid "Searching..." msgstr "Hledání..." #: lazarusidestrconsts.dlgsearchpaths msgid "Paths" msgstr "Cesty" #: lazarusidestrconsts.dlgselectedtext msgid "&Selected Text" msgstr "&Vybraný text" #: lazarusidestrconsts.dlgsetallelementdefault msgid "Set all elements to default" msgstr "Nastavit všechny prvky na výchozí" #: lazarusidestrconsts.dlgsetelementdefault msgid "Set element to default" msgstr "Nastavit prvek na výchozí" #: lazarusidestrconsts.dlgsetpropertyvariable msgid "Set property Variable" msgstr "Nastavit hodnotu vlastnosti" #: lazarusidestrconsts.dlgshowcaps msgid "Show component captions" msgstr "Ukázat titulky komponent" #: lazarusidestrconsts.dlgshowcompiledprocedures msgid "Show compiled procedures" msgstr "Ukázat kompilované procedury" #: lazarusidestrconsts.dlgshowcompileroptions msgid "Show compiler options" msgstr "Zobrazit nastavení překladače" #: lazarusidestrconsts.dlgshowcompilinglinenumbers msgid "Show line numbers" msgstr "Ukázat čísla řádků" #: lazarusidestrconsts.dlgshowconditionals msgid "Show conditionals" msgstr "Ukázat podmínky" #: lazarusidestrconsts.dlgshowdebuginfo msgid "Show debug info" msgstr "Ukázat ladící informace" #: lazarusidestrconsts.dlgshowdefinedmacros msgid "Show defined macros" msgstr "Ukázat definované makra" #: lazarusidestrconsts.dlgshowedrhints msgid "Show editor hints" msgstr "Ukázat pokyny editoru" #: lazarusidestrconsts.dlgshoweverything msgid "Show everything" msgstr "Ukázat vše" #: lazarusidestrconsts.dlgshowexecutableinfo msgid "Show executable info (Win32 only)" msgstr "Ukázat spustitelné informace (pouze Win32)" #: lazarusidestrconsts.dlgshowgeneralinfo msgid "Show general info" msgstr "Ukázat obecné informace" #: lazarusidestrconsts.dlgshowgutterhints msgid "Show gutter hints" msgstr "Ukázat pokyny pomocného sloupce editoru" #: lazarusidestrconsts.dlgshowhint msgid "Show Hints" msgstr "Ukázat pokyny" #: lazarusidestrconsts.dlgshowlinenumbers msgid "Show line numbers" msgstr "Ukázat čísla řádků" #: lazarusidestrconsts.dlgshownotes msgid "Show Notes" msgstr "Ukázat poznámky" #: lazarusidestrconsts.dlgshownothing msgid "Show nothing (only errors)" msgstr "Neukázat nic (pouze chyby)" #: lazarusidestrconsts.dlgshowprocserror msgid "Show all procs on error" msgstr "" #: lazarusidestrconsts.dlgshowscrollhint msgid "Show scroll hint" msgstr "Ukázat pokyny posuvníku" #: lazarusidestrconsts.dlgshowsummary msgid "Show summary" msgstr "Ukázat přehled" #: lazarusidestrconsts.dlgshowtriedfiles msgid "Show tried files" msgstr "Ukázat zkoušené soubory" #: lazarusidestrconsts.dlgshowusedfiles msgid "Show used files" msgstr "Ukázat použité soubory" #: lazarusidestrconsts.dlgshowwarnings msgid "Show Warnings" msgstr "Ukázat varování" #: lazarusidestrconsts.dlgskipforwarddeclarations msgid "Skip forward declarations" msgstr "" #: lazarusidestrconsts.dlgsmarttabs msgid "Smart tabs" msgstr "Chytré záložky" #: lazarusidestrconsts.dlgsmbbehind msgid "Symbol behind (.pp~)" msgstr "Symbol za (.~pp)" #: lazarusidestrconsts.dlgsmbcounter msgid "Counter (.pp;1)" msgstr "Čítač (.pp;1)" #: lazarusidestrconsts.dlgsmbfront msgid "Symbol in front (.~pp)" msgstr "Symbol ve předu (.~pp)" #: lazarusidestrconsts.dlgsnapguidelines msgid "Snap to Guide Lines" msgstr "Přichycovat k vodícím čarám" #: lazarusidestrconsts.dlgspacenotcosmos msgid "Space" msgstr "Mezera" #: lazarusidestrconsts.dlgspbhints msgid "Hints for main speed buttons (open, save, ...)" msgstr "" #: lazarusidestrconsts.dlgsrcedit msgid "Source Editor" msgstr "Editor zdrojového kódu" #: lazarusidestrconsts.dlgsrorigin msgid "Origin" msgstr "Původ" #: lazarusidestrconsts.dlgstatickeyword msgid "Static Keyword in Objects" msgstr "Statická klíčová slova v objektech" #: lazarusidestrconsts.dlgstopafternrerr msgid "Stop after number of errors:" msgstr "Zastavit po počtu chyb:" #: lazarusidestrconsts.dlgsubpropcolor msgid "SubProperties" msgstr "Podvlastnosti" #: lazarusidestrconsts.dlgsyntaxoptions msgid "Syntax options" msgstr "Nastavení syntaxe" #: lazarusidestrconsts.dlgtabindent msgid "Tab indents blocks" msgstr "" #: lazarusidestrconsts.dlgtabstospaces msgid "Tabs to spaces" msgstr "" #: lazarusidestrconsts.dlgtabwidths msgid "Tab widths" msgstr "Šířky záložek" #: lazarusidestrconsts.dlgtargetcpufamily msgid "Target CPU family" msgstr "Cílová rodina CPU" #: lazarusidestrconsts.dlgtargetos msgid "Target OS" msgstr "Cílový OS" #: lazarusidestrconsts.dlgtargetplatform msgid "Target Platform:" msgstr "Cílová platforma:" #: lazarusidestrconsts.dlgtargetproc msgid "Target processor" msgstr "Cílový procesor" #: lazarusidestrconsts.dlgtestprjdir msgid "Directory for building test projects" msgstr "Složka pro sestavení pokusných projektů" #: lazarusidestrconsts.dlgtexttofing msgid "&Text to Find" msgstr "&Text k nalezení" #: lazarusidestrconsts.dlgthedirectory msgid "The directory \"" msgstr "Adresář \"" #: lazarusidestrconsts.dlgtimesecondunit msgid "sec" msgstr "sekund" #: lazarusidestrconsts.dlgtooltipeval msgid "Tooltip expression evaluation" msgstr "Výraz pro vyhodnocení tooltipů." #: lazarusidestrconsts.dlgtooltiptools msgid "Tooltip symbol Tools" msgstr "" #: lazarusidestrconsts.dlgtoppos msgid "Top:" msgstr "Nahoře:" #: lazarusidestrconsts.dlgtplfname msgid "Template file name" msgstr "Jméno souboru šablony" #: lazarusidestrconsts.dlgtrimspacetypecaption msgid "Trim Spaces Style" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypecaretmove msgid "Caret or Edit" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeeditline msgid "Line Edited" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeleaveline msgid "Leave line" msgstr "" #: lazarusidestrconsts.dlgtrimspacetypeposonly msgid "Position Only" msgstr "" #: lazarusidestrconsts.dlgtrimtrailingspaces msgid "Trim trailing spaces" msgstr "Odstranit okrajové mezery" #: lazarusidestrconsts.dlguncertopt msgid "Uncertain Optimizations" msgstr "Neurčitá optimalizace" #: lazarusidestrconsts.dlgundoaftersave msgid "Undo after save" msgstr "Navrátit zpět po uložení" #: lazarusidestrconsts.dlgundogroupoptions msgid "Undo / Redo:" msgstr "" #: lazarusidestrconsts.dlgundolimit msgid "Undo limit" msgstr "Limit vrátitelných akcí" #: lazarusidestrconsts.dlgunitdepbrowse msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts.dlgunitdepcaption msgid "Unit dependencies" msgstr "Závislosti jednotky" #: lazarusidestrconsts.dlgunitdeprefresh msgid "Refresh" msgstr "Obnovit" #: lazarusidestrconsts.dlgunitoutp msgid "Unit output directory (-FU):" msgstr "Výstupní adresář jednotky (-FU):" #: lazarusidestrconsts.dlgunsavedlinecolor msgid "Unsaved line" msgstr "" #: lazarusidestrconsts.dlgupword msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts.dlgusecodefolding msgid "Code folding" msgstr "Zbalování kódu" #: lazarusidestrconsts.dlgusecustomconfig msgid "Use additional Compiler Config File" msgstr "" #: lazarusidestrconsts.dlgusedividerdraw msgid "Divider drawing" msgstr "" #: lazarusidestrconsts.dlgusefpccfg msgid "Use standard Compiler Config File (fpc.cfg)" msgstr "Použít standardní konfigurační soubor překladače (fpc.cfg)" #: lazarusidestrconsts.dlguselaunchingapp msgid "Use launching application" msgstr "Použít spouštěcí aplikaci" #: lazarusidestrconsts.dlgusemsgfile msgid "Use messages file" msgstr "" #: lazarusidestrconsts.dlgusesyntaxhighlight msgid "Use syntax highlight" msgstr "Použít zvýraznění syntaxe" #: lazarusidestrconsts.dlgvaluecolor msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts.dlgverbosity msgid "Verbosity during compilation:" msgstr "Užvaněnost během překládání:" #: lazarusidestrconsts.dlgvisiblegutter msgid "Visible gutter" msgstr "Viditelný pomocný sloupec editoru" #: lazarusidestrconsts.dlgvisiblerightmargin msgid "Visible right margin" msgstr "Viditelný pravý okraj" #: lazarusidestrconsts.dlgwholewordsonly msgid "&Whole Words Only" msgstr "&Pouze celková slova" #: lazarusidestrconsts.dlgwidthpos msgid "Width:" msgstr "Šířka:" #: lazarusidestrconsts.dlgwin32guiapp msgid "Win32 gui application" msgstr "Win32 GUI aplikace" #: lazarusidestrconsts.dlgwindow msgid "Window" msgstr "Okno" #: lazarusidestrconsts.dlgwinpos msgid "Window Positions" msgstr "Poloha okna" #: lazarusidestrconsts.dlgwordspolicies msgid "Words" msgstr "Slova" #: lazarusidestrconsts.dlgwrdpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts.dlgwritefpclogo msgid "Write an FPC logo" msgstr "Zapsat FPC logo" #: lazarusidestrconsts.fdinvalidmultiselectiontext msgid "Multiselected components must be of a single form." msgstr "Hromadně výbrané komponenty musí být z jednoho formuláře." #: lazarusidestrconsts.fdmalignword msgid "Align" msgstr "Zarovnat" #: lazarusidestrconsts.fdmdeleteselection msgid "Delete Selection" msgstr "" #: lazarusidestrconsts.fdmmirrorhorizontal msgid "Mirror horizontal" msgstr "Zrcadlit vodorovně" #: lazarusidestrconsts.fdmmirrorvertical msgid "Mirror vertical" msgstr "Zrcadlit svisle" #: lazarusidestrconsts.fdmorder msgid "Order" msgstr "Řadit" #: lazarusidestrconsts.fdmorderbackone msgid "Back one" msgstr "Zpět o jeden" #: lazarusidestrconsts.fdmorderforwardone msgid "Forward one" msgstr "Dopředu o jedno" #: lazarusidestrconsts.fdmordermovetoback msgid "Move to back" msgstr "Přesunout dozadu" #: lazarusidestrconsts.fdmordermovetofront msgid "Move to front" msgstr "Přesunout dopředu" #: lazarusidestrconsts.fdmsaveformasxml msgid "Save form as xml" msgstr "Uložit formulář jako xml" #: lazarusidestrconsts.fdmscaleword msgid "Scale" msgstr "Měřítko" #: lazarusidestrconsts.fdmselectall msgid "Select All" msgstr "" #: lazarusidestrconsts.fdmsizeword msgid "Size" msgstr "Velikost" #: lazarusidestrconsts.fdmsnaptogridoption msgid "Option: Snap to grid" msgstr "Volba: Přitáhnout k mřížce" #: lazarusidestrconsts.fdmsnaptoguidelinesoption msgid "Option: Snap to guide lines" msgstr "Voba: Přitáhnout k vodícím čarám" #: lazarusidestrconsts.fdmtaborder msgid "Tab order..." msgstr "Pořadí záložek" #: lazarusidestrconsts.gldhighlightbothsidesofcursor msgid "On Both Sides" msgstr "Na obou stranách" #: lazarusidestrconsts.lisa2paddfile msgid "Add File" msgstr "Přidat soubor" #: lazarusidestrconsts.lisa2paddfiles msgid "Add Files" msgstr "Přidat soubory" #: lazarusidestrconsts.lisa2paddfilestopackage msgid "Add files to package" msgstr "Přidat soubory do balíčku" #: lazarusidestrconsts.lisa2paddlfmlrsfilesiftheyexist msgid "Add LFM, LRS files, if they exist" msgstr "Přidat soubory LFM a LRS pokud existují." #: lazarusidestrconsts.lisa2paddtopackage msgid "Add to package" msgstr "Přidat do balíčku" #: lazarusidestrconsts.lisa2paddunit msgid "Add Unit" msgstr "Přidat jednotku" #: lazarusidestrconsts.lisa2pambiguousancestortype msgid "Ambiguous Ancestor Type" msgstr "Nejednoznačný typ předka" #: lazarusidestrconsts.lisa2pambiguousclassname msgid "Ambiguous Class Name" msgstr "Nejednoznačné jméno třídy" #: lazarusidestrconsts.lisa2pambiguousunitname msgid "Ambiguous Unit Name" msgstr "Nejednoznačné jméno jednotky" #: lazarusidestrconsts.lisa2pancestortype msgid "Ancestor Type" msgstr "Typ předka" #: lazarusidestrconsts.lisa2papascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts.lisa2pbrokendependencies msgid "Broken Dependencies" msgstr "Porušená závislost" #: lazarusidestrconsts.lisa2pchooseanexistingfile msgid "" msgstr "" #: lazarusidestrconsts.lisa2pclassnamealreadyexists msgid "Class Name already exists" msgstr "Jméno třídy již existuje" #: lazarusidestrconsts.lisa2pcreatenewfile msgid "Create new file" msgstr "Vytvořit nový soubor" #: lazarusidestrconsts.lisa2pdependency msgid "Dependency" msgstr "Závislost" #: lazarusidestrconsts.lisa2pexistingfile msgid "%sExisting file: %s%s%s" msgstr "%sExistující soubor: %s%s%s" #: lazarusidestrconsts.lisa2pfilealreadyexists msgid "File already exists" msgstr "Soubor již existuje" #: lazarusidestrconsts.lisa2pfilealreadyexistsintheproject msgid "File %s%s%s already exists in the project." msgstr "Soubor %s%s%s již existuje v projektu" #: lazarusidestrconsts.lisa2pfilealreadyinpackage msgid "File already in package" msgstr "Soubor je již obsažen v balíčku" #: lazarusidestrconsts.lisa2pfileisused msgid "File is used" msgstr "Soubor je použit" #: lazarusidestrconsts.lisa2pfilename msgid "File name:" msgstr "Jméno souboru:" #: lazarusidestrconsts.lisa2pfilename2 msgid "Filename" msgstr "Jméno souboru" #: lazarusidestrconsts.lisa2pfilenotunit msgid "File not unit" msgstr "Soubor není jednotka" #: lazarusidestrconsts.lisa2pinvalidancestortype msgid "Invalid Ancestor Type" msgstr "Neplatný typ předka" #: lazarusidestrconsts.lisa2pinvalidcircle msgid "Invalid Circle" msgstr "Neplatný kruh" #: lazarusidestrconsts.lisa2pinvalidclassname msgid "Invalid Class Name" msgstr "Neplatné jméno třídy" #: lazarusidestrconsts.lisa2pinvalidfile msgid "Invalid file" msgstr "Neplatný soubor" #: lazarusidestrconsts.lisa2pinvalidfilename msgid "Invalid filename" msgstr "Neplatné jméno souboru" #: lazarusidestrconsts.lisa2pinvalidunitname msgid "Invalid Unit Name" msgstr "Neplatné jméno jednotky" #: lazarusidestrconsts.lisa2pisnotavalidunitname msgid "%s%s%s is not a valid unit name." msgstr "%s%s%s není platné jméno jednotky." #: lazarusidestrconsts.lisa2pnewclassname msgid "New class name:" msgstr "Nové jméno třídy:" #: lazarusidestrconsts.lisa2pnewcomponent msgid "New Component" msgstr "Nová komponenta" #: lazarusidestrconsts.lisa2pnewfile msgid "New File" msgstr "Nový soubor" #: lazarusidestrconsts.lisa2pnopackagefoundfordependencypleasechooseanexisting msgid "No package found for dependency %s%s%s.%sPlease choose an existing package." msgstr "Pro závislost %s%s%s nebyl nalezen balíček.%sProsím vyberte existující balíček." #: lazarusidestrconsts.lisa2ppagenametoolong msgid "Page Name too long" msgstr "Jméno stránky je příliš dlouhé" #: lazarusidestrconsts.lisa2ppalettepage msgid "Palette Page:" msgstr "Stránka sady:" #: lazarusidestrconsts.lisa2ppascalunitsmusthavetheextensionpporpas msgid "Pascal units must have the extension .pp or .pas" msgstr "Pascalovské jednotky musí mít příponu .pp nebo .pas" #: lazarusidestrconsts.lisa2psavefiledialog msgid "Save file dialog" msgstr "Dialog uložení souboru" #: lazarusidestrconsts.lisa2pshortenorexpandfilename msgid "Shorten or expand filename" msgstr "Zkrátit nebo rozšířit jméno souboru" #: lazarusidestrconsts.lisa2pshowall msgid "Show all" msgstr "Ukázat vše" #: lazarusidestrconsts.lisa2pswitchpaths msgid "Switch Paths" msgstr "Přepnout cesty" #: lazarusidestrconsts.lisa2ptheancestortypehasthesamenameastheunit msgid "The ancestor type %s%s%s has the same name as%sthe unit %s%s%s." msgstr "Typ předka %s%s%S má stejné jméno jako %sjednotka %s%s%s." #: lazarusidestrconsts.lisa2ptheancestortypeisnotavalidpascalidentifier msgid "The ancestor type %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lisa2ptheclassnameandancestortypearethesame msgid "The class name %s%s%s and ancestor type %s%s%s are the same." msgstr "Jméno třídy %s%s%s a typ předka %s%s%s jsou totžné." #: lazarusidestrconsts.lisa2ptheclassnameexistsalreadyinpackagefile msgid "The class name %s%s%s exists already in%sPackage %s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts.lisa2ptheclassnamehasthesamenameastheunit msgid "The class name %s%s%s has the same name as%sthe unit %s%s%s." msgstr "" #: lazarusidestrconsts.lisa2ptheclassnameisnotavalidpascalidentifier msgid "The class name %s%s%s is not a valid pascal identifier." msgstr "Jméno třídy %s%s%s není platný identifikátor pascalu." #: lazarusidestrconsts.lisa2pthefileisalreadyinthepackage msgid "The file %s%s%s is already in the package." msgstr "Soubor %s%s%s už je v balíčku." #: lazarusidestrconsts.lisa2pthefileispartofthecurrentprojectitisabadidea msgid "The file %s%s%s is part of the current project.%sIt is a bad idea to share files between projects and packages." msgstr "Soubor %s%s%s je částí aktuálního projektu.%sSdílet soubory mezi projekty a balíčky je špatný nápad." #: lazarusidestrconsts.lisa2pthefilenameisambiguouspleasespecifiyafilename msgid "The filename %s%s%s is ambiguous, because the package has no default directory yet.%sPlease specify a filename with full path." msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionisinvalidpleaseusetheformatmajor msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts.lisa2ptheminimumversionisinvalidpleaseusetheformatmajor msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisa2pthepackagehasalreadyadependencyforthe msgid "The package has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts.lisa2pthepackagenameisinvalidpleasechooseanexisting msgid "The package name %s%s%s is invalid.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts.lisa2pthepagenameistoolongmax100chars msgid "The page name %s%s%s is too long (max 100 chars)." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthepackage msgid "The unitname %s%s%s already exists in the package:%s%s" msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamealreadyexistsinthispackage msgid "The unitname %s%s%s already exists in this package." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnameandfilenamediffer msgid "The unit name %s%s%s%sand filename %s%s%s differ." msgstr "" #: lazarusidestrconsts.lisa2ptheunitnamedoesnotcorrespondtothefilename msgid "The unit name %s%s%s does not correspond to the filename." msgstr "Jméno jednotky %s%s%s nesouhlasí s názvem souboru." #: lazarusidestrconsts.lisa2ptheunitnameisthesameasanregisteredcomponent msgid "The unit name %s%s%s is the same as an registered component.%sUsing this can cause strange error messages." msgstr "Jméno jednotky %s%s%s je stejné jako má registrované komponenta.%sToto použití může způsobit podivná" #: lazarusidestrconsts.lisa2punitfilename msgid "Unit file name:" msgstr "Jméno souboru jednotky:" #: lazarusidestrconsts.lisa2punitfilename2 msgid "Unit File Name:" msgstr "Jméno souboru jednotky:" #: lazarusidestrconsts.lisa2punitname msgid "Unit Name:" msgstr "Jméno jednotky:" #: lazarusidestrconsts.lisa2punitnamealreadyexists msgid "Unitname already exists" msgstr "Jméno jednotky už existuje" #: lazarusidestrconsts.lisa2punitnameinvalid msgid "Unit Name Invalid" msgstr "Neplatné jméno jednotky" #: lazarusidestrconsts.lisa2pupdateunitnameandhasregisterprocedure msgid "Scan Unit for Unit Name and Register procedure" msgstr "Prohlédnout jednotku pro jméno jednotky a registrační proceduru" #: lazarusidestrconsts.lisabandonchanges msgid "Abandon changes?" msgstr "Zrušit změny?" #: lazarusidestrconsts.lisabcreationfailed msgid "Error occured during Application Bundle creation: " msgstr "Nastala chyba během vytváření balíku aplikace:" #: lazarusidestrconsts.lisabortall msgid "Abort all" msgstr "Přerušit vše" #: lazarusidestrconsts.lisabortallloading msgid "Abort all loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts.lisabortloadingproject msgid "Abort loading project" msgstr "Přerušit načítání projektu" #: lazarusidestrconsts.lisabortwholeloading msgid "Abort whole loading" msgstr "Přerušit celé načítání" #: lazarusidestrconsts.lisaboutdocumentation msgid "Documentation:" msgstr "Dokumentace:" #: lazarusidestrconsts.lisaboutlazarus msgid "About Lazarus" msgstr "O Lazarusu" #: lazarusidestrconsts.lisaboutlazarusmsg msgid "License: GPL/LGPL%sLazarus is an IDE to create (graphical and console) applications with Free Pascal. Free Pascal is a (L)GPL'ed Pascal and Object Pascal compiler that runs on Windows, Linux, Mac OS X, FreeBSD and more.%sLazarus is the missing part of the puzzle that will allow you to develop programs for all of the above platforms in a Delphi like environment. The IDE is a RAD tool that includes a form designer.%sAs Lazarus is growing we need more developers." msgstr "" #: lazarusidestrconsts.lisaboutnocontributors msgid "Cannot find contributors list." msgstr "Nelze nalézt seznam přispěvatelů." #: lazarusidestrconsts.lisaboutofficial msgid "Official:" msgstr "Oficiální:" #: lazarusidestrconsts.lisacannotholdtcontrolsyoucanonlyputnonvisualcomponen msgid "A %s can not hold TControls.%sYou can only put non visual components on it." msgstr "%s nemůže obsahovat TControls.%sMůžete na ni dát pouze negrafické komponenty." #: lazarusidestrconsts.lisacknowledgements msgid "Acknowledgements" msgstr "Poděkování" #: lazarusidestrconsts.lisaction msgid "Action:" msgstr "" #: lazarusidestrconsts.lisactivateregularexpressionsyntaxfortextandreplaceme msgid "Activate regular expression syntax for text and replacement (pretty much like perl)" msgstr "Aktivovat syntaxi regulárních výrazů pro text a nahrazení (dost podobný jako perl)" #: lazarusidestrconsts.lisactivefilter msgid "Active Filter" msgstr "Aktivní filtr" #: lazarusidestrconsts.lisadddirectory msgid "Add directory" msgstr "Přidat adresář" #: lazarusidestrconsts.lisaddfilesofdirectory msgid "Add files of directory" msgstr "Přidat soubory nebo z adresáře" #: lazarusidestrconsts.lisadditionalcompileroptionsinheritedfrompackages msgid "Additional compiler options inherited from packages" msgstr "Přídavné volby překladače zděděné z balíčků." #: lazarusidestrconsts.lisadditionalinformation msgid "Additional Information" msgstr "Doplňující informace" #: lazarusidestrconsts.lisaddnewset msgid "Add new set" msgstr "Přidat novou sadu" #: lazarusidestrconsts.lisaddtoproject msgid "Add %s to project?" msgstr "Přidat %s do projektu?" #: lazarusidestrconsts.lisaddtounitsearchpath msgid "Add to unit search path?" msgstr "Přidat do vyhledávací cesty jednotek" #: lazarusidestrconsts.lisaddvalue msgid "Add value:" msgstr "" #: lazarusidestrconsts.lisaf2paddfiletoapackage msgid "Add file to a package" msgstr "Přidat soubor do balíčku" #: lazarusidestrconsts.lisaf2pdestinationpackage msgid "Destination Package" msgstr "Cílový balíček" #: lazarusidestrconsts.lisaf2pfiletype msgid "File Type" msgstr "Typ souboru" #: lazarusidestrconsts.lisaf2phasregisterprocedure msgid "Has Register procedure" msgstr "Má registrační proceduru" #: lazarusidestrconsts.lisaf2pinvalidpackage msgid "Invalid Package" msgstr "Neplatný balíček" #: lazarusidestrconsts.lisaf2pinvalidpackageid msgid "Invalid package ID: %s%s%s" msgstr "Neplatné ID balíčku: %s%s%s" #: lazarusidestrconsts.lisaf2pisvirtualunit msgid "Virtual unit (source is not in package)" msgstr "Virtuální jednotka (zdrojové soubory nejsou v balíčku)" #: lazarusidestrconsts.lisaf2ppackageisreadonly msgid "Package is read only" msgstr "Balíček je pouze pro čtení" #: lazarusidestrconsts.lisaf2ppackagenotfound msgid "Package %s%s%s not found." msgstr "Balíček %s%s%s nenalezen." #: lazarusidestrconsts.lisaf2pshowall msgid "Show All" msgstr "Ukázat vše" #: lazarusidestrconsts.lisaf2pthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "Soubor %s%s%s%s již je v balíčku %s." #: lazarusidestrconsts.lisaf2pthepackageisreadonly msgid "The package %s is read only." msgstr "Balíček %s je pouze pro čtení." #: lazarusidestrconsts.lisaf2punitname msgid "Unit Name: " msgstr "Jméno jednotky:" #: lazarusidestrconsts.lisafilealreadyexistsreplaceit msgid "A file %s%s%s already exists.%sReplace it?" msgstr "Soubor %s%s%s už existuje.%sNahradit?" #: lazarusidestrconsts.lisalignment msgid "Alignment" msgstr "Zarovnání" #: lazarusidestrconsts.lisallblockslooksok msgid "All blocks looks ok." msgstr "Všechny bloky vypadají dobře." #: lazarusidestrconsts.lisallfiles msgid "All Files" msgstr "Všechny soubory" #: lazarusidestrconsts.lisallowfunctio msgid "Allow Function Calls" msgstr "Povolit volání funkcí" #: lazarusidestrconsts.lisallowsearchingformultiplelines msgid "Allow searching for multiple lines" msgstr "Povolit vyhledávání více řádků" #: lazarusidestrconsts.lisallyourmodificationstowillbelostandthefilereopened msgid "All your modifications to %s%s%s%swill be lost and the file reopened." msgstr "Všechny vaše úpravy v %s%s%s%s budou ztraceny a soubor bude otevřen znovu." #: lazarusidestrconsts.lisalternativekey msgid "Alternative key" msgstr "Alternativní klávesa" #: lazarusidestrconsts.lisalternativekeyor2keysequence msgid "Alternative key (or 2 key sequence)" msgstr "Alternativní klávesa (nebo sekvence dvou kláves)" #: lazarusidestrconsts.lisalways msgid "Always" msgstr "" #: lazarusidestrconsts.lisambiguousfilefound msgid "Ambiguous file found" msgstr "Nalezen nejasný soubor" #: lazarusidestrconsts.lisambiguousfilefoundthisfilecanbemistakenwithdelete msgid "Ambiguous file found: %s%s%s%sThis file can be mistaken with %s%s%s%s%sDelete the ambiguous file?" msgstr "Nalezen nejednoznačný soubor: %s%s%s%sTento soubor může být chybě zaměněn za %s%s%s%s%sSmazat nejednoznačný soubor?" #: lazarusidestrconsts.lisambiguousfilesfound msgid "Ambiguous files found" msgstr "Nejednoznačné soubory nalezeny" #: lazarusidestrconsts.lisambiguousunitfound msgid "Ambiguous Unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts.lisambiguousunitfound2 msgid "Ambiguous unit found" msgstr "Nejednoznačná jednotka nalezena" #: lazarusidestrconsts.lisanchoreditornocontrolselected msgid "Anchor Editor - no control selected" msgstr "Editor ukotvení - nevybrán žádný ovládací prvek" #: lazarusidestrconsts.lisanchorenabledhint msgid "Enabled = Include %s in Anchors" msgstr "Povolený = Včetně %s v kotvách" #: lazarusidestrconsts.lisanchorsofselectedcontrols msgid "Anchors of selected controls" msgstr "Ukotvení vybraného ovládacího prvku" #: lazarusidestrconsts.lisanchortobottomsidekeepborderspace msgid "Anchor to bottom side of sibling, keep border space" msgstr "Ukotvit k dolní straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts.lisanchortoleftsidekeepborderspace msgid "Anchor to left side of sibling, keep border space" msgstr "Ukotvit k levé straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts.lisanchortorightsidekeepborderspace msgid "Anchor to right side of sibling, keep border space" msgstr "Ukotvit k pravý straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts.lisanchortotopsidekeepborderspace msgid "Anchor to top side of sibling, keep border space" msgstr "Ukotvit k horní straně sourozence, udržovat okrajový prostor" #: lazarusidestrconsts.lisanerroroccuredatlaststartupwhileloadingloadthispro msgid "An error occured at last startup while loading %s!%s%sLoad this project again?" msgstr "Při posledním startu došlo k chybě při načítání %s!%s%sNačíst znovu tento projekt?" #: lazarusidestrconsts.lisapplicationagraphicallclfreepascalprogramtheprogra msgid "Application%sA graphical lcl/freepascal program. The program file is automatically maintained by lazarus." msgstr "Aplikace%sGrafický program LCL/FreePascal. Soubor programu je automaticky spravován Lazarusem." #: lazarusidestrconsts.lisapplicationclassname msgid "&Application class name" msgstr "&Jméno třídy aplikace" #: lazarusidestrconsts.lisapplybuildflagsbtodependenciestoo msgid "apply build flags (-B) to dependencies too" msgstr "příznaky sestavení (-B) použít také pro závislosti" #: lazarusidestrconsts.lisaroundborderspacehint msgid "Borderspace around the control. The other four borderspaces are added to this value." msgstr "Okrajový prostor kolem ovládacího prvku. Další čtyři okrajové prostory jsou přidány k této hodnotě." #: lazarusidestrconsts.lisasimplepascalprogramfilethiscanbeusedforquickanddi msgid "A simple Pascal Program file.%sThis can be used for quick and dirty testing.%sBetter create a new project." msgstr "Soubor jednoduchého pascalovkého programu.%sLze jej použit pro rychlé a špinavé testování.%sLepší je vytvořit nový projekt." #: lazarusidestrconsts.lisaskbeforereplacingeachfoundtext msgid "Ask before replacing each found text" msgstr "Zeptat před nahrazením každého nalezeného textu" #: lazarusidestrconsts.lisautocontinue msgid "Auto Continue" msgstr "" #: lazarusidestrconsts.lisautomaticallyonlinebreak msgid "line break" msgstr "odsazení řádku" #: lazarusidestrconsts.lisautomaticallyonspace msgid "space" msgstr "mezera" #: lazarusidestrconsts.lisautomaticallyonwordend msgid "word end" msgstr "konec slova" #: lazarusidestrconsts.lisautomaticallyremovecharacter msgid "do not add character" msgstr "nepřidávat znak" #: lazarusidestrconsts.lisautomaticfeatures msgid "Automatic features" msgstr "Automatická vlastnost" #: lazarusidestrconsts.lisautoshowobjectinspector msgid "Auto show" msgstr "Automaticky ukázat" #: lazarusidestrconsts.lisavailablepackages msgid "Available packages" msgstr "Dostupné balíčky" #: lazarusidestrconsts.lisbackupfilefailed msgid "Backup file failed" msgstr "Zálohování souboru selhalo" #: lazarusidestrconsts.lisbddchangingthepackagenameorversionbreaksdependencies msgid "Changing the package name or version breaks dependencies. Should these dependencies be changed as well?%sSelect Yes to change all listed dependencies.%sSelect Ignore to break the dependencies and continue." msgstr "Změna jména nebo verze balíčku naruší závislosti. Měly by být změněny také tyto závislosti?%sVyberte Ano ke změně všech uvedených závislostí.%sVyberte Ignorovat k porušení závislostí a pokračování." #: lazarusidestrconsts.lisbegins msgid "begins" msgstr "začátky" #: lazarusidestrconsts.lisbehindrelated msgid "Behind related" msgstr "" #: lazarusidestrconsts.lisbfalwaysbuildbeforerun msgid "Always Build before Run" msgstr "Vždy sestavit před spuštěním" #: lazarusidestrconsts.lisbfbuildcommand msgid "Build Command" msgstr "Sestavit povel" #: lazarusidestrconsts.lisbfonbuildprojectexecutethebuildfilecommandinstead msgid "On build project execute the Build File command instead" msgstr "" #: lazarusidestrconsts.lisbfonrunprojectexecutetherunfilecommandinstead msgid "On run project execute the Run File command instead" msgstr "" #: lazarusidestrconsts.lisbfruncommand msgid "Run Command" msgstr "Spustit příkaz" #: lazarusidestrconsts.lisbfwhenthisfileisactiveinsourceeditor msgid "When this file is active in source editor ..." msgstr "Když tento soubor je aktivní v editoru ..." #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath msgid "Working directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts.lisbfworkingdirectoryleaveemptyforfilepath2 msgid "Working Directory (Leave empty for file path)" msgstr "Pracovní složka (nechejte prázné pro cestu souboru)" #: lazarusidestrconsts.lisboldnondefaultobjectinspector msgid "Bold non default values" msgstr "" #: lazarusidestrconsts.lisborderspace msgid "BorderSpace" msgstr "Okrajový prostor" #: lazarusidestrconsts.lisbottom msgid "Bottom" msgstr "Dolní" #: lazarusidestrconsts.lisbottomborderspacespinedithint msgid "Bottom borderspace. This value is added to base borderspace and used for the space below the control." msgstr "Dolní okrajový prostor. Tato hodnota je přidána k základnímu okraji a je použita pro místo pod prvkem." #: lazarusidestrconsts.lisbottomgroupboxcaption msgid "Bottom anchoring" msgstr "Dolní ukotvení" #: lazarusidestrconsts.lisbottoms msgid "Bottoms" msgstr "Spodní části" #: lazarusidestrconsts.lisbottomsiblingcomboboxhint msgid "This is the sibling control to which the bottom side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisbottomspaceequally msgid "Bottom space equally" msgstr "Dolní prostor stejnoměrně" #: lazarusidestrconsts.lisbreak msgid "Break" msgstr "Přerušit" #: lazarusidestrconsts.lisbrowseforcompiler msgid "Browse for Compiler (%s)" msgstr "Procházet pro překladač" #: lazarusidestrconsts.lisbtnbreak msgid "Break" msgstr "" #: lazarusidestrconsts.lisbtncontinue msgid "Continue" msgstr "" #: lazarusidestrconsts.lisbtnfind msgid "&Find" msgstr "" #: lazarusidestrconsts.lisbtnreplace msgid "&Replace" msgstr "" #: lazarusidestrconsts.lisbuildallfilesofprojectpackageide msgid "build all files of project/package/IDE" msgstr "sestavit všechny soubory projektu/balíčku/IDE" #: lazarusidestrconsts.lisbuildidewithpackages msgid "build IDE with packages" msgstr "sestavit IDE s balíčky" #: lazarusidestrconsts.lisbuildnewproject msgid "Build new project" msgstr "Sestavit nový projekt" #: lazarusidestrconsts.lisbuildnumber msgid "Build Number" msgstr "Číslo sestavení" #: lazarusidestrconsts.liscallingtocreatemakefilefromfailed msgid "Calling %s to create Makefile from %s failed." msgstr "Volání %s k vytvoření Makefile z %s selhalo." #: lazarusidestrconsts.liscancelloadingthiscomponent msgid "Cancel loading this component" msgstr "Zrušit načítání této komponenty" #: lazarusidestrconsts.liscancelloadingunit msgid "Cancel loading unit" msgstr "Zrušit načítání jednotky" #: lazarusidestrconsts.liscancelrenaming msgid "Cancel renaming" msgstr "Zrušit přejmenování" #: lazarusidestrconsts.liscannotcopytoplevelcomponent msgid "Can not copy top level component." msgstr "Nelze zkopírovat komponentu na nejvyšší úrovni." #: lazarusidestrconsts.liscannotcreatefile msgid "Can not create file %s%s%s" msgstr "Nelze vytvořit soubor %s%s%s" #: lazarusidestrconsts.liscannotfindlazarusstarter msgid "Cannot find lazarus starter:%s%s" msgstr "Nelze nalézt spouštěš lazarusu:%s%s" #: lazarusidestrconsts.liscanonlychangetheclassoftcomponents msgid "Can only change the class of TComponents." msgstr "Změnit lze pouze třídu dědící TComponent." #: lazarusidestrconsts.lisccdchangeclassof msgid "Change Class of %s" msgstr "Změnit třídu %s" #: lazarusidestrconsts.lisccdnoclass msgid "no class" msgstr "žádná třída" #: lazarusidestrconsts.lisccoambiguouscompiler msgid "Ambiguous compiler" msgstr "Nejednoznačný překladač" #: lazarusidestrconsts.lisccochecktestdir msgid "Please check the Test directory under %sEnvironment -> Environment Options -> Files -> Directory for building test projects" msgstr "Prosím zkontrolujte adresář Test v %sProstředí -> Nastavení prostředí -> Soubory -> Adresář pro sestavení" #: lazarusidestrconsts.lisccocompilernotanexe msgid "The compiler \"%s\" is not an executable file.%sDetails: %s" msgstr "Překladač \"%s\" není spustitelný soubor.%sPodrobnosti: %s" #: lazarusidestrconsts.lisccocontains msgid "contains " msgstr "obsahuje" #: lazarusidestrconsts.lisccocopyoutputtocliboard msgid "Copy output to clipboard" msgstr "Zkopírovat výstup do schránky" #: lazarusidestrconsts.lisccodatesdiffer msgid "The dates of the .ppu files of FPC differ more than one hour.%sThis can mean, they are from two different installations.%sFile1: %s%sFile2: %s" msgstr "" #: lazarusidestrconsts.lisccoenglishmessagefilemissing msgid "english message file for fpc is missing:components/codetools/fpc.errore.msg" msgstr "chybí soubor anglických hlášení pro fpc:components/codetools/fpc.errore.msg" #: lazarusidestrconsts.lisccoerrorcaption msgid "Error" msgstr "Chyba" #: lazarusidestrconsts.lisccoerrormsg msgid "ERROR: " msgstr "CHYBA:" #: lazarusidestrconsts.lisccofpcunitpathhassource msgid "FPC unit path contains a source: " msgstr "Cesta jednotky FPC obsahuje zdrojový kód:" #: lazarusidestrconsts.lisccohasnewline msgid "new line symbols" msgstr "nové řádkové symboly" #: lazarusidestrconsts.lisccohintmsg msgid "HINT: " msgstr "POKYN:" #: lazarusidestrconsts.lisccoinvalidcompiler msgid "Invalid compiler" msgstr "Neplatný překladač" #: lazarusidestrconsts.lisccoinvalidsearchpath msgid "Invalid search path" msgstr "Neplatná hledací cesta" #: lazarusidestrconsts.lisccoinvalidtestdir msgid "Invalid Test Directory" msgstr "Neplatný testovací adresář" #: lazarusidestrconsts.lisccomissingunit msgid "Missing unit" msgstr "Chybějcí jednotka" #: lazarusidestrconsts.lisccomsgppunotfound msgid "compiled FPC unit not found: %s.ppu" msgstr "" #: lazarusidestrconsts.lisccomultiplecfgfound msgid "multiple compiler configs found: " msgstr "nalezeno více konfigurací překladače:" #: lazarusidestrconsts.liscconocfgfound msgid "no fpc.cfg found" msgstr "nenalezen žádný fpc.cfg" #: lazarusidestrconsts.lisccononascii msgid "non ASCII" msgstr "ne ASCII" #: lazarusidestrconsts.lisccoppuexiststwice msgid "ppu exists twice: %s, %s" msgstr "ppu existuje dvakrát: %s, %s" #: lazarusidestrconsts.lisccoppunotfounddetailed msgid "The compiled FPC unit %s.ppu was not found.%sThis typically means your fpc.cfg has a bug. Or your FPC installation is broken." msgstr "" #: lazarusidestrconsts.lisccoppuolderthancompiler msgid "There is a .ppu file older than the compiler itself:%s%s" msgstr "" #: lazarusidestrconsts.lisccorelunitpathfoundincfg msgid "relative unit path found in fpc cfg: %s" msgstr "" #: lazarusidestrconsts.lisccoseveralcompilers msgid "There are several FreePascal Compilers in your path.%s%s%sMaybe you forgot to delete an old compiler?" msgstr "Ve vaší cestě je několik překladačů Free Pascalu.%s%s%sMožná jste zapoměli smazat starý překladač?" #: lazarusidestrconsts.lisccoskip msgid "Skip" msgstr "Přeskočit" #: lazarusidestrconsts.lisccospaces msgid "spaces" msgstr "mezery" #: lazarusidestrconsts.lisccospecialcharacters msgid "special characters" msgstr "speciální znaky" #: lazarusidestrconsts.lisccotestssuccess msgid "All tests succeeded." msgstr "Všechny testy se zdařily." #: lazarusidestrconsts.lisccounabletocreatetestfile msgid "Unable to create Test File" msgstr "Nelze vytvořit testovací soubor" #: lazarusidestrconsts.lisccounabletocreatetestpascalfile msgid "Unable to create Test pascal file \"%s\"." msgstr "Nelze vytvořit testovací pascalovský soubor \"%s\"." #: lazarusidestrconsts.lisccounabletogetfiledate msgid "Unable to get file date of %s." msgstr "Nelze získat datum souboru %s." #: lazarusidestrconsts.lisccounusualchars msgid "unusual characters" msgstr "neobvyklé znaky" #: lazarusidestrconsts.lisccowarningcaption msgid "Warning" msgstr "Varování" #: lazarusidestrconsts.lisccowarningmsg msgid "WARNING: " msgstr "VAROVÁNÍ: " #: lazarusidestrconsts.lisccowrongpathdelimiter msgid "wrong path delimiter" msgstr "špatný oddělovač cest" #: lazarusidestrconsts.liscecategories msgid "Categories" msgstr "Skupiny" #: lazarusidestrconsts.liscecomplexitygroup msgid "Complexity" msgstr "" #: lazarusidestrconsts.lisceconstants msgid "Constants" msgstr "Konstanty" #: lazarusidestrconsts.lisceemptyblocks msgid "Empty blocks" msgstr "" #: lazarusidestrconsts.lisceemptyclasssections msgid "Empty class sections" msgstr "" #: lazarusidestrconsts.lisceemptygroup msgid "Empty constructs" msgstr "" #: lazarusidestrconsts.lisceemptyprocedures msgid "Empty procedures" msgstr "" #: lazarusidestrconsts.liscefilter msgid "(Filter)" msgstr "(Filtr)" #: lazarusidestrconsts.liscefollowcursor msgid "Follow cursor" msgstr "Následovat kurzor" #: lazarusidestrconsts.liscein msgid "%s in %s" msgstr "" #: lazarusidestrconsts.lisceisarootcontrol msgid "Is a root control" msgstr "" #: lazarusidestrconsts.liscelongparamlistcount msgid "Parameters count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscelongprocedures msgid "Long procedures" msgstr "" #: lazarusidestrconsts.liscelongproclinecount msgid "Line count of procedure treated as \"long\"" msgstr "" #: lazarusidestrconsts.liscemanynestedprocedures msgid "Many nested procedures" msgstr "" #: lazarusidestrconsts.liscemanyparameters msgid "Many parameters" msgstr "" #: lazarusidestrconsts.liscemodeshowcategories msgid "Show Categories" msgstr "Ukázat kategorie" #: lazarusidestrconsts.liscemodeshowsourcenodes msgid "Show Source Nodes" msgstr "Ukázat uzly zdroje" #: lazarusidestrconsts.liscenestedproccount msgid "Nested procedures count treating as \"many\"" msgstr "" #: lazarusidestrconsts.liscentercontrolhorizontallyrelativetosibling msgid "Center control horizontally relative to the given sibling" msgstr "" #: lazarusidestrconsts.liscentercontrolverticallyrelativetosibling msgid "Center control vertically relative to the given sibling" msgstr "" #: lazarusidestrconsts.liscenterinwindow msgid "Center in window" msgstr "Vystředit v okně" #: lazarusidestrconsts.liscenters msgid "Centers" msgstr "Vystředit" #: lazarusidestrconsts.lisceomode msgid "Preferred Exhibition Mode" msgstr "Uprřednostněný prezentační režim" #: lazarusidestrconsts.lisceomodecategory msgid "Category" msgstr "Skupina" #: lazarusidestrconsts.lisceomodesource msgid "Source" msgstr "Zdroj" #: lazarusidestrconsts.lisceoneveronlymanually msgid "Never, only manually" msgstr "Nikdy, pouze ručně" #: lazarusidestrconsts.lisceonlyusedincategorymode msgid "Only used in category mode" msgstr "Použito pouze v režimu kategorie" #: lazarusidestrconsts.lisceoonidle msgid "On idle" msgstr "Při nečinnosti" #: lazarusidestrconsts.lisceorefreshautomatically msgid "Refresh automatically" msgstr "Obnovit automaticky" #: lazarusidestrconsts.lisceothergroup msgid "Other" msgstr "" #: lazarusidestrconsts.lisceoupdate msgid "Update" msgstr "Aktualizovat" #: lazarusidestrconsts.lisceowhenswitchingfile msgid "When switching file in source editor" msgstr "Když přepínání souboru v zdrojovém editoru" #: lazarusidestrconsts.lisceprocedures msgid "Procedures" msgstr "Procedury" #: lazarusidestrconsts.lisceproperties msgid "Properties" msgstr "Vlastnosti" #: lazarusidestrconsts.liscepublishedpropertywithoutdefault msgid "Published properties without default" msgstr "" #: lazarusidestrconsts.lisceshowcodeobserver msgid "Show observerations about" msgstr "" #: lazarusidestrconsts.liscestylegroup msgid "Style" msgstr "" #: lazarusidestrconsts.liscetodos msgid "ToDos" msgstr "" #: lazarusidestrconsts.liscetypes msgid "Types" msgstr "Typy" #: lazarusidestrconsts.lisceunnamedconstants msgid "Unnamed constants" msgstr "" #: lazarusidestrconsts.lisceunsortedmembers msgid "Unsorted members" msgstr "" #: lazarusidestrconsts.lisceunsortedvisibility msgid "Unsorted visibility" msgstr "" #: lazarusidestrconsts.lisceuses msgid "Uses" msgstr "Užití" #: lazarusidestrconsts.liscevariables msgid "Variables" msgstr "Proměnné" #: lazarusidestrconsts.liscewrongindentation msgid "Wrong indentation" msgstr "" #: lazarusidestrconsts.lischangeclass msgid "Change Class" msgstr "Změnit třídu" #: lazarusidestrconsts.lischangeencoding msgid "Change Encoding" msgstr "Změnit kódování" #: lazarusidestrconsts.lischangefile msgid "Change file" msgstr "Změnit soubor" #: lazarusidestrconsts.lischangeparent msgid "Change parent ..." msgstr "Změnit rodiče..." #: lazarusidestrconsts.lischaracter msgid "Character" msgstr "Znak" #: lazarusidestrconsts.lischaractermap msgid "Character Map" msgstr "Mapa znaků" #: lazarusidestrconsts.lischeckchangesondiskwithloading msgid "Check changes on disk with loading" msgstr "Zkontrolovat změny na disku s načtením" #: lazarusidestrconsts.lischeckoptions msgid "Check options" msgstr "Zkontrolovat nastavení" #: lazarusidestrconsts.lischooseadifferentname msgid "Choose a different name" msgstr "Vyberte jiné jméno" #: lazarusidestrconsts.lischooseafpdoclink msgid "Choose a FPDoc link" msgstr "Vyberte odkaz FPDoc" #: lazarusidestrconsts.lischooseakey msgid "Choose a key ..." msgstr "Vyberte klávesu..." #: lazarusidestrconsts.lischoosecompilerpath msgid "Choose compiler filename (%s)" msgstr "Vyberte jméno souboru překladače (%s)" #: lazarusidestrconsts.lischoosedebuggerpath msgid "Choose debugger filename" msgstr "Vyberte jméno souboru ladiče" #: lazarusidestrconsts.lischoosedelphipackage msgid "Choose Delphi package (*.dpk)" msgstr "Vyberte balíček Delphi (.dpk)" #: lazarusidestrconsts.lischoosedelphiproject msgid "Choose Delphi project (*.dpr)" msgstr "Vyberte projekt Delphi (*.dpr)" #: lazarusidestrconsts.lischoosedelphiunit msgid "Choose Delphi unit (*.pas)" msgstr "Vyberte jednotku Delphi (*.pas)" #: lazarusidestrconsts.lischoosedirectory msgid "Choose directory" msgstr "Vyberte adresář" #: lazarusidestrconsts.lischoosefpcsourcedir msgid "Choose FPC source directory" msgstr "Vyberte zdrojový adresář FPC" #: lazarusidestrconsts.lischooselazarussourcedirectory msgid "Choose Lazarus Directory" msgstr "Vyberte adresář Lazarusu" #: lazarusidestrconsts.lischoosemakepath msgid "Choose make path" msgstr "Vyberte cestu k make" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewfile msgid "Choose one of these items to create a new File" msgstr "K vytvoření nového souboru vyberte jednu z položek" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewpackage msgid "Choose one of these items to create a new Package" msgstr "" #: lazarusidestrconsts.lischooseoneoftheseitemstocreateanewproject msgid "Choose one of these items to create a new Project" msgstr "" #: lazarusidestrconsts.lischooseoneoftheseitemstoinheritfromanexistingone msgid "Choose one of these items to inherit from an existing one" msgstr "" #: lazarusidestrconsts.lischooseprogramsourcepppaslpr msgid "Choose program source (*.pp,*.pas,*.lpr)" msgstr "Vyberte zdrojový soubor programu (*.pp,*.pas,*.lpr)" #: lazarusidestrconsts.lischoosestructuretoencloseselection msgid "Choose structure to enclose selection" msgstr "Vyberte strukturu k obklopení výběru" #: lazarusidestrconsts.lischoosetestbuilddir msgid "Choose the directory for tests" msgstr "Vyberte adresář na zkoušky" #: lazarusidestrconsts.lisclasscompletion msgid "Class Completion" msgstr "" #: lazarusidestrconsts.lisclassconflictswithlfmfiletheunitusestheunitwhic msgid "Class conflicts with .lfm file:%sThe unit %s%suses the unit %s%swhich contains the class %s,%sbut the .lfm file contains already another class.%sThere can only be one design class per unit.%sPlease move %s to another unit." msgstr "" #: lazarusidestrconsts.lisclassisnotaregisteredcomponentclassunabletopaste msgid "Class %s%s%s is not a registered component class.%sUnable to paste." msgstr "" #: lazarusidestrconsts.lisclassnotfound msgid "Class not found" msgstr "Třída nenalezena" #: lazarusidestrconsts.lisclassofmethodnotfound msgid "Class %s%s%s of method %s%s%s not found." msgstr "" #: lazarusidestrconsts.liscldircleandirectory msgid "Clean Directory" msgstr "Vyčistit adresář" #: lazarusidestrconsts.liscldircleansubdirectories msgid "Clean sub directories" msgstr "Vyčistit podadresáře" #: lazarusidestrconsts.liscldirkeepalltextfiles msgid "Keep all text files" msgstr "Udržovat všechny textové soubory" #: lazarusidestrconsts.liscldirkeepfilesmatchingfilter msgid "Keep files matching filter" msgstr "" #: lazarusidestrconsts.liscldirremovefilesmatchingfilter msgid "Remove files matching filter" msgstr "" #: lazarusidestrconsts.liscldirsimplesyntaxeginsteadof msgid "Simple Syntax (e.g. * instead of .*)" msgstr "Jednoduchá syntaxe (např. * namísto .*)" #: lazarusidestrconsts.liscleanlazarussource msgid "Clean Lazarus Source" msgstr "Vyčistit zdrojové soubory Lazarusu" #: lazarusidestrconsts.liscleanupunitpath msgid "Clean up unit path?" msgstr "Vyčistit cestu jednotky?" #: lazarusidestrconsts.liscleardirectory msgid "Clear Directory?" msgstr "Vyprázdnit adresář?" #: lazarusidestrconsts.lisclickheretobrowsethefilehint msgid "Click here to browse the file" msgstr "K procházení souboru klikněte zde" #: lazarusidestrconsts.lisclose msgid "&Close" msgstr "&Zavřít" #: lazarusidestrconsts.liscmdlinelclinterfacespecificoptions msgid "LCL Interface specific options:" msgstr "Volby rozhraní LCL:" #: lazarusidestrconsts.liscmparameter msgid "Parameter" msgstr "Parametr" #: lazarusidestrconsts.liscmplstcomponents msgid "Components" msgstr "Komponenty" #: lazarusidestrconsts.liscmplstinheritance msgid "Inheritance" msgstr "Dědičnost" #: lazarusidestrconsts.liscmplstlist msgid "List" msgstr "Seznam" #: lazarusidestrconsts.liscmplstpalette msgid "Palette" msgstr "Paleta" #: lazarusidestrconsts.liscoambiguousadditionalcompilerconfigfile msgid "Ambiguous additional compiler config file" msgstr "Nejednoznačný přídavný konfigurační soubor překladače" #: lazarusidestrconsts.liscocallon msgid "Call on:" msgstr "Volat při:" #: lazarusidestrconsts.liscocallonbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts.liscocalloncompile msgid "Compile" msgstr "Přeložit" #: lazarusidestrconsts.liscocallonrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts.liscoclickokifaresuretodothat msgid "%s%sClick OK if you are sure to do that." msgstr "%s%sKlikněte na OK pokud jste si jisti, že to chcete udělat." #: lazarusidestrconsts.liscocommand msgid "Command:" msgstr "Příkaz:" #: lazarusidestrconsts.liscodebrowser msgid "Code browser" msgstr "Prohlížeš kódu" #: lazarusidestrconsts.liscodeexplorer msgid "Code Explorer" msgstr "Prohlížeč kódu" #: lazarusidestrconsts.liscodefault msgid "default (%s)" msgstr "výchozí (%s)" #: lazarusidestrconsts.liscodegenerationoptions msgid "Code generation options" msgstr "Nastavení vytváření kódu" #: lazarusidestrconsts.liscodehelpaddlinkbutton msgid "Add link" msgstr "Přidat odkaz" #: lazarusidestrconsts.liscodehelpaddpathbutton msgid "Add path" msgstr "Přidat cestu" #: lazarusidestrconsts.liscodehelpbrowseexamplebutton msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts.liscodehelpconfirmreplace msgid "Confirm replace" msgstr "Potvrdit nahrazení" #: lazarusidestrconsts.liscodehelpcreatebutton msgid "Create help item" msgstr "Vytvořit položku nápovědy" #: lazarusidestrconsts.liscodehelpdeletelinkbutton msgid "Delete link" msgstr "Odstranit vazbu" #: lazarusidestrconsts.liscodehelpdeletepathbutton msgid "Remove path" msgstr "Odstranit cestu" #: lazarusidestrconsts.liscodehelpdescrtag msgid "Description" msgstr "Popis" #: lazarusidestrconsts.liscodehelperrorstag msgid "Errors" msgstr "Chyby" #: lazarusidestrconsts.liscodehelpexampletag msgid "Example" msgstr "Příklad" #: lazarusidestrconsts.liscodehelphintboldformat msgid "Insert bold formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintinsertcodetag msgid "Insert code formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintitalicformat msgid "Insert italic formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintremarktag msgid "Insert remark formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintunderlineformat msgid "Insert underline formatting tag" msgstr "" #: lazarusidestrconsts.liscodehelphintvartag msgid "Insert var formatting tag" msgstr "Vložit značku formátování proměnné" #: lazarusidestrconsts.liscodehelpinherited msgid "Inherited" msgstr "Zděděný" #: lazarusidestrconsts.liscodehelpinsertalink msgid "Insert a link ..." msgstr "Vložit odkaz..." #: lazarusidestrconsts.liscodehelpinsertparagraphformattingtag msgid "Insert paragraph formatting tag" msgstr "Vložit značku formátování odstavce" #: lazarusidestrconsts.liscodehelpmainformcaption msgid "FPDoc editor" msgstr "Editor FPDoc" #: lazarusidestrconsts.liscodehelpnodocumentation msgid "(none)" msgstr "(žádný)" #: lazarusidestrconsts.liscodehelpnoinheriteddescriptionfound msgid "(no inherited description found)" msgstr "(nenalezen zděděný popis)" #: lazarusidestrconsts.liscodehelpnotagcaption msgid "" msgstr "<ŽÁDNÝ>" #: lazarusidestrconsts.liscodehelppathsgroupbox msgid "FPDoc files path" msgstr "Cesta souborů FPDoc" #: lazarusidestrconsts.liscodehelpreplacebutton msgid "Replace" msgstr "Nahradit" #: lazarusidestrconsts.liscodehelpsavebutton msgid "Save" msgstr "Uložit" #: lazarusidestrconsts.liscodehelpseealsotag msgid "See also" msgstr "Související informace" #: lazarusidestrconsts.liscodehelpshortdescriptionof msgid "Short description of" msgstr "Krátky popis " #: lazarusidestrconsts.liscodehelpshorttag msgid "Short" msgstr "Krátký" #: lazarusidestrconsts.liscodehelpshowemptymethods msgid "Show empty methods" msgstr "Ukázat prázdné metody" #: lazarusidestrconsts.liscodehelpshowunusedunits msgid "Show unused units" msgstr "" #: lazarusidestrconsts.liscodeobignoreconstinfuncs msgid "Ignore constants in next functions" msgstr "" #: lazarusidestrconsts.liscodeobscharconst msgid "Search for unnamed char constants" msgstr "" #: lazarusidestrconsts.liscodeobserver msgid "Code Observer" msgstr "" #: lazarusidestrconsts.liscodeobsignoreeconstants msgid "Ignore next unnamed constants" msgstr "" #: lazarusidestrconsts.liscodetempladd msgid "Add" msgstr "Přidat" #: lazarusidestrconsts.liscodetempladdcodetemplate msgid "Add code template" msgstr "Přidat šablonu kódu" #: lazarusidestrconsts.liscodetemplatokenalreadyexists msgid " A token %s%s%s already exists! " msgstr " Symbol %s%s%s již existuje! " #: lazarusidestrconsts.liscodetemplautocompleteon msgid "Auto complete on ..." msgstr "Automatické dokončení na ..." #: lazarusidestrconsts.liscodetemplchange msgid "Change" msgstr "Změnit" #: lazarusidestrconsts.liscodetemplcomment msgid "Comment:" msgstr "Komentář:" #: lazarusidestrconsts.liscodetempleditcodetemplate msgid "Edit code template" msgstr "Upravit šablonu kódu" #: lazarusidestrconsts.liscodetemplerror msgid "Error" msgstr "Chyba" #: lazarusidestrconsts.liscodetempltoken msgid "Token:" msgstr "Znak:" #: lazarusidestrconsts.liscodetools msgid "CodeTools" msgstr "CodeTools" #: lazarusidestrconsts.liscodetoolsdefsaction msgid "Action: %s" msgstr "Akce: %s" #: lazarusidestrconsts.liscodetoolsdefsautocreatednodesreadonly msgid "Auto created nodes can not be edited,%snor can they have non auto created child nodes." msgstr "Automaticky generované uzly nelze editovat,%sa tak nemůže mít neautomaticky vytvořené uzly potomků." #: lazarusidestrconsts.liscodetoolsdefsautogenerated msgid "%s, auto generated" msgstr "%s, automaticky generováno" #: lazarusidestrconsts.liscodetoolsdefsautogeneratednodescannotbeedited msgid "Auto generated nodes can not be edited." msgstr "Automaticky generované uzly nelze editovat." #: lazarusidestrconsts.liscodetoolsdefsblock msgid "Block" msgstr "Blok" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefineseditor msgid "CodeTools Defines Editor" msgstr "Editor definic CodeTools" #: lazarusidestrconsts.liscodetoolsdefscodetoolsdefinespreview msgid "CodeTools Defines Preview" msgstr "Náhled definic CodeTools" #: lazarusidestrconsts.liscodetoolsdefscompilerpath msgid "compiler path" msgstr "Cesta překladače" #: lazarusidestrconsts.liscodetoolsdefsconvertnode msgid "Convert node" msgstr "Převést uzel" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesfordirectory msgid "Create Defines for %s Directory" msgstr "Vytvořit definice pro adresář %s" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalcompiler msgid "Create Defines for Free Pascal Compiler" msgstr "Vytvořit definice pro překladač Free Pascal" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforfreepascalsvnsources msgid "Create Defines for Free Pascal SVN Sources" msgstr "Vytvořit definice pro SVN zdroje Free Pascalu" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforlazarusdir msgid "Create Defines for Lazarus Directory" msgstr "Vytvořit definice pro složku Lazarusu" #: lazarusidestrconsts.liscodetoolsdefscreatedefinesforproject msgid "Create Defines for %s Project" msgstr "Vytvořit definice pro projekt %s" #: lazarusidestrconsts.liscodetoolsdefscreatefpcmacrosandpathsforafpcprojectdirectory msgid "Create FPC Macros and paths for a fpc project directory" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdefine msgid "Define" msgstr "Defiovat" #: lazarusidestrconsts.liscodetoolsdefsdefinerecurse msgid "Define Recurse" msgstr "Definovat rekurentně" #: lazarusidestrconsts.liscodetoolsdefsdeletenode msgid "Delete node" msgstr "Odstranit uzel" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdelphimaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: C:/Programme/Borland/Delphi%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsdescription msgid "Description:" msgstr "Popis:" #: lazarusidestrconsts.liscodetoolsdefsdirectory msgid "%s directory" msgstr "%s složka" #: lazarusidestrconsts.liscodetoolsdefsedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts.liscodetoolsdefselse msgid "Else" msgstr "Jinak" #: lazarusidestrconsts.liscodetoolsdefselseif msgid "ElseIf" msgstr "JinakPokud" #: lazarusidestrconsts.liscodetoolsdefserrorreading msgid "Error reading %s%s%s%s%s" msgstr "Chyba čtení %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorreadingprojectinfofile msgid "Error reading project info file %s%s%s%s%s" msgstr "Chyba čtení informací o projektu ze souboru %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewriting msgid "Error while writing %s%s%s%s%s" msgstr "Chyba během zapisování %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefserrorwhilewritingprojectinfofile msgid "Error while writing project info file %s%s%s%s%s" msgstr "Chyba během zapisování informačního souboru projektu %s%s%s%s%s" #: lazarusidestrconsts.liscodetoolsdefsexit msgid "Exit" msgstr "Ukončit" #: lazarusidestrconsts.liscodetoolsdefsexitwithoutsave msgid "Exit without Save" msgstr "Ukončit bez uložení" #: lazarusidestrconsts.liscodetoolsdefsfpcsvnsourcedirectory msgid "FPC SVN source directory" msgstr "SVN zdrojový adresář FPC" #: lazarusidestrconsts.liscodetoolsdefsif msgid "If" msgstr "Pokud" #: lazarusidestrconsts.liscodetoolsdefsifdef msgid "IfDef" msgstr "PokudDefinováno" #: lazarusidestrconsts.liscodetoolsdefsifndef msgid "IfNDef" msgstr "PokudNedefinováno" #: lazarusidestrconsts.liscodetoolsdefsinsertbehinddirectory msgid "Directory" msgstr "Složka" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5compilertemp msgid "Insert Delphi 5 Compiler Template" msgstr "Vložit šablonu překladače Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5directorytem msgid "Insert Delphi 5 Directory Template" msgstr "Vložit šablonu adresáře Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi5projecttempl msgid "Insert Delphi 5 Project Template" msgstr "Vložit šablonu projektu Delphi 5" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6compilertemp msgid "Insert Delphi 6 Compiler Template" msgstr "Vložit šablonu překladače Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6directorytem msgid "Insert Delphi 6 Directory Template" msgstr "Vložit šablonu adresáře Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi6projecttempl msgid "Insert Delphi 6 Project Template" msgstr "Vložit šablonu projektu Delphi 6" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7compilertemp msgid "Insert Delphi 7 Compiler Template" msgstr "Vložit šablonu překladače Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7directorytem msgid "Insert Delphi 7 Directory Template" msgstr "Vložit šablonu adresáře Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertdelphi7projecttempl msgid "Insert Delphi 7 Project Template" msgstr "Vložit šablonu projektu Delphi 7" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalcompilert msgid "Insert Free Pascal Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalprojectte msgid "Insert Free Pascal Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertfreepascalsvnsource msgid "Insert Free Pascal SVN Source Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3compilertemp msgid "Insert Kylix 3 Compiler Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3directorytem msgid "Insert Kylix 3 Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertkylix3projecttempl msgid "Insert Kylix 3 Project Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertlazarusdirectorytem msgid "Insert Lazarus Directory Template" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertnodeaschild msgid "Insert node as child" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinsertnodebelow msgid "Insert node below" msgstr "" #: lazarusidestrconsts.liscodetoolsdefsinserttemplate msgid "Insert Template" msgstr "Vložit šablonu" #: lazarusidestrconsts.liscodetoolsdefsinvalidparent msgid "Invalid parent" msgstr "neplatný rodič" #: lazarusidestrconsts.liscodetoolsdefsinvalidparentnode msgid "Invalid parent node" msgstr "Neplatný rodičovský uzel" #: lazarusidestrconsts.liscodetoolsdefsinvalidpreviousnode msgid "Invalid previous node" msgstr "Neplatný předchozí uzel" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectorydesc msgid "The %s main directory,%swhere Borland has installed all %s sources.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefskylixmaindirectoryforproject msgid "The %s main directory,%swhere Borland has installed all %s sources,%swhich are used by this %s project.%sFor example: /home/user/kylix%s" msgstr "" #: lazarusidestrconsts.liscodetoolsdefslazarusdirectory msgid "Lazarus Directory" msgstr "Adresář Lazarusu" #: lazarusidestrconsts.liscodetoolsdefsmovenodedown msgid "Move node down" msgstr "Přesunout uzel dolů" #: lazarusidestrconsts.liscodetoolsdefsmovenodeoneleveldown msgid "Move node one level down" msgstr "Přesunout uzel o jednu úroveň dolů" #: lazarusidestrconsts.liscodetoolsdefsmovenodeonelevelup msgid "Move node one level up" msgstr "Přesunout uzel o jednu úroveň nahoru" #: lazarusidestrconsts.liscodetoolsdefsmovenodeup msgid "Move node up" msgstr "Přesunout uzel nahoru" #: lazarusidestrconsts.liscodetoolsdefsname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts.liscodetoolsdefsnewnode msgid "NewNode" msgstr "Nový uzel" #: lazarusidestrconsts.liscodetoolsdefsnodeanditschildrenareonly msgid "Node and its children are only valid for this project" msgstr "Uzel a jeho děti jsou platné pouze pro tento projekt" #: lazarusidestrconsts.liscodetoolsdefsnodeisreadonly msgid "Node is readonly" msgstr "Uzel je pouze pro čtení" #: lazarusidestrconsts.liscodetoolsdefsnoneselected msgid "none selected" msgstr "žádné vybrané" #: lazarusidestrconsts.liscodetoolsdefsparentnodecannotcontainch msgid "Parent node can not contain child nodes." msgstr "Rozičovský uzel nemůže obsahovat dětské uzly." #: lazarusidestrconsts.liscodetoolsdefspreviousnodecannotcontainchildnodes msgid "Previous node can not contain child nodes." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts.liscodetoolsdefsprojectdirectory2 msgid "%s project directory" msgstr "%s složka projektu" #: lazarusidestrconsts.liscodetoolsdefsprojectspecific msgid "%s, project specific" msgstr "%s, údaje projektu" #: lazarusidestrconsts.liscodetoolsdefsreaderror msgid "Read error" msgstr "Chyba čtení" #: lazarusidestrconsts.liscodetoolsdefssaveandexit msgid "Save and Exit" msgstr "Uložit a ukončit" #: lazarusidestrconsts.liscodetoolsdefsselectednode msgid "Selected Node:" msgstr "Vybrat uzel:" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalcvssourcedirectory msgid "The Free Pascal SVN source directory. Not required. This will improve find declarationand debugging." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthefreepascalprojectdirectory msgid "The Free Pascal project directory." msgstr "Adresář projektu Free Pascalu." #: lazarusidestrconsts.liscodetoolsdefsthefreepascalsvnsourcedir msgid "The Free Pascal SVN source directory." msgstr "Zdrojový adresář SVN Free Pascalu" #: lazarusidestrconsts.liscodetoolsdefsthelazarusmaindirectory msgid "The Lazarus main directory." msgstr "Hlavní adresář Lazarusu" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforexample msgid "The path to the free pascal compiler.%s For example %s/usr/bin/%s -n%s or %s/usr/local/bin/fpc @/etc/fpc.cfg%s." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsthepathtothefreepascalcompilerforthisproject msgid "The path to the free pascal compiler for this project. Only required if you set the FPC SVN source below. Used to autocreate macros." msgstr "" #: lazarusidestrconsts.liscodetoolsdefstheprojectdirectory msgid "The %s project directory,%swhich contains the .dpr, dpk file." msgstr "" #: lazarusidestrconsts.liscodetoolsdefsundefine msgid "Undefine" msgstr "Oddefinovat" #: lazarusidestrconsts.liscodetoolsdefsundefineall msgid "Undefine All" msgstr "Oddefinovat vše" #: lazarusidestrconsts.liscodetoolsdefsundefinerecurse msgid "Undefine Recurse" msgstr "Oddefinovat rekurentně" #: lazarusidestrconsts.liscodetoolsdefsvalueasfilepaths msgid "Value as File Paths" msgstr "Hodnota jako cesty souboru" #: lazarusidestrconsts.liscodetoolsdefsvalueastext msgid "Value as Text" msgstr "Hodnota jako text" #: lazarusidestrconsts.liscodetoolsdefsvariable msgid "Variable:" msgstr "Proměnná:" #: lazarusidestrconsts.liscodetoolsdefswriteerror msgid "Write error" msgstr "Chyba zápisu" #: lazarusidestrconsts.liscodetoolsoptsat msgid "At" msgstr "u" #: lazarusidestrconsts.liscodetoolsoptsbracket msgid "Bracket" msgstr "" #: lazarusidestrconsts.liscodetoolsoptscolon msgid "Colon" msgstr "Dvojtečka" #: lazarusidestrconsts.liscodetoolsoptscomma msgid "Comma" msgstr "Čárka" #: lazarusidestrconsts.liscodetoolsoptsidentifier msgid "Identifier" msgstr "Identifikátor" #: lazarusidestrconsts.liscodetoolsoptskeyword msgid "Keyword" msgstr "Klíčové slovo" #: lazarusidestrconsts.liscodetoolsoptsnewline msgid "Newline" msgstr "Nový řádek" #: lazarusidestrconsts.liscodetoolsoptsnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts.liscodetoolsoptsnumber msgid "Number" msgstr "Číslo" #: lazarusidestrconsts.liscodetoolsoptsok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts.liscodetoolsoptspoint msgid "Point" msgstr "Bod" #: lazarusidestrconsts.liscodetoolsoptssemicolon msgid "Semicolon" msgstr "Středník" #: lazarusidestrconsts.liscodetoolsoptsspace msgid "Space" msgstr "Mezera" #: lazarusidestrconsts.liscodetoolsoptsstringconst msgid "String constant" msgstr "Konstantní řetězec" #: lazarusidestrconsts.liscodetoolsoptssymbol msgid "Symbol" msgstr "Symbol" #: lazarusidestrconsts.liscoexecuteafter msgid "Execute after" msgstr "Spustit pak" #: lazarusidestrconsts.liscoexecutebefore msgid "Execute before" msgstr "Spustit před" #: lazarusidestrconsts.liscollapseallclasses msgid "Collapse all classes" msgstr "" #: lazarusidestrconsts.liscollapseallpackages msgid "Collapse all packages" msgstr "" #: lazarusidestrconsts.liscollapseallunits msgid "Collapse all units" msgstr "" #: lazarusidestrconsts.liscommandafter msgid "Command after" msgstr "" #: lazarusidestrconsts.liscommandafterinvalid msgid "Command after invalid" msgstr "" #: lazarusidestrconsts.liscommandafterpublishingmodule msgid "Command after publishing module" msgstr "" #: lazarusidestrconsts.liscommandlineparamsofprogram msgid "Command line parameters of program" msgstr "Parametry příkazového řádku programu" #: lazarusidestrconsts.liscomments msgid "Comments:" msgstr "Komentáře:" #: lazarusidestrconsts.liscompany msgid "Company:" msgstr "Společnost:" #: lazarusidestrconsts.liscompileidewithoutlinking msgid "Compile IDE (without linking)" msgstr "Přeložit IDE (bez vazeb)" #: lazarusidestrconsts.liscompiler msgid "Compiler" msgstr "Překladač" #: lazarusidestrconsts.liscompilererror msgid "Compiler error" msgstr "Chyba překladače" #: lazarusidestrconsts.liscompilererrorinvalidcompiler msgid "Error: invalid compiler: %s" msgstr "Chyba: neplatný kompilátor: %s" #: lazarusidestrconsts.liscompilerfilename msgid "Compiler filename" msgstr "Jméno souboru překladače" #: lazarusidestrconsts.liscompilerhintyoucansetthecompilerpath msgid "Hint: you can set the compiler path in Environment->Environment options->Files->Compiler Path" msgstr "" #: lazarusidestrconsts.liscompilernotecodetoolsconfigfilenotfoundusingdefaults msgid "NOTE: codetools config file not found - using defaults" msgstr "" #: lazarusidestrconsts.liscompilernoteloadingoldcodetoolsoptionsfile msgid "NOTE: loading old codetools options file: " msgstr "" #: lazarusidestrconsts.liscompileroptionsforproject msgid "Compiler Options for Project: %s" msgstr "Volby překladače pro projekt %s" #: lazarusidestrconsts.liscompiling msgid "%s (compiling ...)" msgstr "%s (kompilování ...)" #: lazarusidestrconsts.liscomponent msgid "Component" msgstr "Komponenta" #: lazarusidestrconsts.liscomponentnameiskeyword msgid "Component name %s%s%s is keyword" msgstr "Jméno komponenty je klíčové slovo" #: lazarusidestrconsts.liscomponentnameisnotavalididentifier msgid "Component name %s%s%s is not a valid identifier" msgstr "Jméno komponenty není platný identifikátor" #: lazarusidestrconsts.liscomppalfindcomponent msgid "Find component" msgstr "Najít komponentu" #: lazarusidestrconsts.liscomppalopenpackage msgid "Open package" msgstr "Otevřít balíček" #: lazarusidestrconsts.liscomppalopenunit msgid "Open unit" msgstr "Otevřít jednotku" #: lazarusidestrconsts.liscomptest msgid "&Test" msgstr "" #: lazarusidestrconsts.liscondition msgid "Condition" msgstr "Podmínka" #: lazarusidestrconsts.lisconfigdirectory msgid "Lazarus config directory" msgstr "Konfigurační adresář Lazarusu" #: lazarusidestrconsts.lisconfigurebuild msgid "Configure Build %s" msgstr "Nastavit sestavení %s" #: lazarusidestrconsts.lisconfigurebuildlazarus msgid "Configure %sBuild Lazarus%s" msgstr "Nastavení %sSestavení Lazarusu%s" #: lazarusidestrconsts.lisconfirmchanges msgid "Confirm changes" msgstr "Potvrdit změny" #: lazarusidestrconsts.lisconfirmdelete msgid "Confirm delete" msgstr "" #: lazarusidestrconsts.lisconfirmlazarusrebuild msgid "Do you want to rebuild Lazarus?" msgstr "Chcete znovu sestavit Lazarus?" #: lazarusidestrconsts.lisconfirmnewpackagesetfortheide msgid "Confirm new package set for the IDE" msgstr "Potvrdit novou sadu balíčků pro IDE" #: lazarusidestrconsts.lisconsoleapplication msgid "Console application" msgstr "Konzolová aplikace" #: lazarusidestrconsts.lisconstructorcode msgid "Constructor code" msgstr "" #: lazarusidestrconsts.liscontains msgid "contains" msgstr "obsahuje" #: lazarusidestrconsts.liscontinue msgid "Continue" msgstr "Pokračovat" #: lazarusidestrconsts.liscontinuewithoutloadingform msgid "Continue without loading form" msgstr "Pokračovat bez načtení formuláře" #: lazarusidestrconsts.liscontributors msgid "Contributors" msgstr "Přispěvatelé" #: lazarusidestrconsts.liscontrolneedsparent msgid "Control needs parent" msgstr "" #: lazarusidestrconsts.lisconversionerror msgid "Conversion error" msgstr "Chyba převodu" #: lazarusidestrconsts.lisconvert msgid "Convert" msgstr "Převést" #: lazarusidestrconsts.lisconvertencoding msgid "Convert encoding" msgstr "Převést kódování" #: lazarusidestrconsts.lisconvertencodingofprojectspackages msgid "Convert encoding of projects/packages" msgstr "Převést kódování projektů/balíčků" #: lazarusidestrconsts.lisconvertprojectorpackage msgid "Convert project or package" msgstr "Převést projekt nebo balíček" #: lazarusidestrconsts.liscopyall msgid "Copy All" msgstr "Kopírovat vše" #: lazarusidestrconsts.liscopyallandhiddenmessagestoclipboard msgid "Copy all and hidden messages to clipboard" msgstr "Zkopírovat všechny a skryté zprávy do schránky" #: lazarusidestrconsts.liscopyallmessagestoclipboard msgid "Copy all messages to clipboard" msgstr "Zkopírovat všechny zprávy do schránky" #: lazarusidestrconsts.liscopyerror msgid "Copy Error" msgstr "Chyba kopírování" #: lazarusidestrconsts.liscopyerror2 msgid "Copy error" msgstr "Chyba kopírování" #: lazarusidestrconsts.liscopyingawholeformisnotimplemented msgid "Copying a whole form is not implemented." msgstr "Kopírování celého formuláře není implementováno." #: lazarusidestrconsts.liscopyselectedmessagestoclipboard msgid "Copy selected messages to clipboard" msgstr "Zkopírovat vybraná hlášení do schránky" #: lazarusidestrconsts.liscoscanforfpcmessages msgid "Scan for FPC messages" msgstr "" #: lazarusidestrconsts.liscoscanformakemessages msgid "Scan for Make messages" msgstr "" #: lazarusidestrconsts.liscoshowallmessages msgid "Show all messages" msgstr "Ukázat všechna hlášení" #: lazarusidestrconsts.liscoskipcallingcompiler msgid "Skip calling Compiler" msgstr "Přeskočit volání překladače" #: lazarusidestrconsts.liscotargetosspecificoptions msgid "Target OS specific options" msgstr "Speciální nastavení pro cílový OS" #: lazarusidestrconsts.liscouldnotadditomainsource msgid "Could not add %s{$I %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddrtomainsource msgid "Could not add %s{$R %s%s} to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotaddtomainsource msgid "Could not add %s%s%s to main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremovefrommainsource msgid "Could not remove %s%s%s from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoveifrommainsource msgid "Could not remove %s{$I %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscouldnotremoverfrommainsource msgid "Could not remove %s{$R %s%s} from main source!" msgstr "" #: lazarusidestrconsts.liscovarious msgid "%s (various)" msgstr "%s (různé)" #: lazarusidestrconsts.liscowarningtheadditionalcompilerconfigfilehasthesamena msgid "Warning: The additional compiler config file has the same name, as one of the standard config filenames the FreePascal compiler is looking for. This can result in ONLY parsing the additional config and skipping the standard config." msgstr "Varování: Doplňující konfigurační soubor překladače má stejné jméno jako jeden ze standardních konfiguračních souborů, které hledá FreePascal. To bude mít za následek parsování pouze doplňujícího souboru a přeskočení standardní konfigurace." #: lazarusidestrconsts.liscpopenpackage msgid "Open Package %s" msgstr "Otevřít balíček %s" #: lazarusidestrconsts.liscpopenunit msgid "Open Unit %s" msgstr "Otevřít jednotku %s" #: lazarusidestrconsts.liscreateaprojectfirst msgid "Create a project first!" msgstr "Vytvořte nejdříve projekt!" #: lazarusidestrconsts.liscreatedirectory msgid "Create directory?" msgstr "Vytvořit adresář?" #: lazarusidestrconsts.liscreatefunction msgid "Create function" msgstr "" #: lazarusidestrconsts.liscreatehelpnode msgid "Create Help node" msgstr "Vytvořit uzel nápovědy" #: lazarusidestrconsts.liscreateit msgid "Create it" msgstr "" #: lazarusidestrconsts.liscreatenewproject msgid "Create new project" msgstr "Vytvořit nový projekt" #: lazarusidestrconsts.lisctdefchoosedirectory msgid "Choose Directory" msgstr "Vyberte adresář" #: lazarusidestrconsts.lisctdefcodetoolsdirectoryvalues msgid "CodeTools Directory Values" msgstr "" #: lazarusidestrconsts.lisctdefdefinetemplates msgid "Define templates" msgstr "Definovat šablony" #: lazarusidestrconsts.lisctdefnovariableselected msgid "" msgstr "" #: lazarusidestrconsts.lisctdefsopenpreview msgid "Open Preview" msgstr "Otevřít náhled" #: lazarusidestrconsts.lisctdefstools msgid "Tools" msgstr "Nástroje" #: lazarusidestrconsts.lisctdefvariable msgid "Variable: %s" msgstr "Proměnná: %s" #: lazarusidestrconsts.lisctdefvariablename msgid "Variable Name" msgstr "Jméno proměné" #: lazarusidestrconsts.lisctdtemplates msgid "Templates" msgstr "Šablony" #: lazarusidestrconsts.lisctinsertmacro msgid "Insert Macro" msgstr "Vložit makro" #: lazarusidestrconsts.lisctpleaseselectamacro msgid "please select a macro" msgstr "vyberte makro prosím" #: lazarusidestrconsts.lisctselectcodemacro msgid "Select Code Macro" msgstr "Vybrat makro kódu" #: lazarusidestrconsts.liscurrent msgid "Current" msgstr "Aktuální" #: lazarusidestrconsts.liscursorcolumnincurrenteditor msgid "Cursor column in current editor" msgstr "Sloupec kurzoru v aktuálním editoru" #: lazarusidestrconsts.liscursorrowincurrenteditor msgid "Cursor row in current editor" msgstr "Řádek kurzoru v aktuálním editoru" #: lazarusidestrconsts.liscustomoptions msgid "custom options" msgstr "vlastní nastavení" #: lazarusidestrconsts.liscustomoptions2 msgid "Custom options" msgstr "Vlastní nastavení" #: lazarusidestrconsts.liscustomprogram msgid "Custom Program" msgstr "Vlastní program" #: lazarusidestrconsts.liscustomprogramafreepascalprogram msgid "Custom Program%sA freepascal program." msgstr "Vlastní program%sFreepascal program." #: lazarusidestrconsts.lisdate msgid "Date" msgstr "Datum" #: lazarusidestrconsts.lisdbgmangnodebuggerspecified msgid "No debugger specified" msgstr "Nebyl učený ladící nástroj" #: lazarusidestrconsts.lisdbgmangsetthebreakpointanyway msgid "Set the breakpoint anyway" msgstr "Přesto nastavit bod přerušení" #: lazarusidestrconsts.lisdbgmangthereisnodebuggerspecifiedsettingbreakpointshaveno msgid "There is no debugger specified.%sSetting breakpoints have no effect until you setup a Debugger in the debugger options dialog in the menu." msgstr "" #: lazarusidestrconsts.lisdebuggererror msgid "Debugger error" msgstr "Chyba ladiče" #: lazarusidestrconsts.lisdebuggererrorooopsthedebuggerenteredtheerrorstate msgid "Debugger error%sOoops, the debugger entered the error state%sSave your work now !%sHit Stop, and hope the best, we're pulling the plug." msgstr "" #: lazarusidestrconsts.lisdebuggerinvalid msgid "Debugger invalid" msgstr "Neplatný ladič" #: lazarusidestrconsts.lisdebugging msgid "%s (debugging ...)" msgstr "%s (ladění ...)" #: lazarusidestrconsts.lisdebugoptionsfrmaddexception msgid "Add Exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmadditionalsearchpath msgid "Additional search path" msgstr "Doplňující prohledávací cesty" #: lazarusidestrconsts.lisdebugoptionsfrmbreakpoint msgid "Breakpoint" msgstr "Bod přerušení" #: lazarusidestrconsts.lisdebugoptionsfrmclearlogonrun msgid "Clear log on run" msgstr "Smazat záznam při spuštění" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggergeneraloptions msgid "Debugger general options" msgstr "Obecná nastavení ladícího nástroje" #: lazarusidestrconsts.lisdebugoptionsfrmdebuggerspecific msgid "Debugger specific options (depends on type of debugger)" msgstr "Speciální nastavení pro ladič (záleží na typu ladiče)" #: lazarusidestrconsts.lisdebugoptionsfrmduplicateexceptionname msgid "Duplicate Exception name" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmenterexceptionname msgid "Enter the name of the exception" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmeventlog msgid "Event Log" msgstr "Záznam událostí" #: lazarusidestrconsts.lisdebugoptionsfrmhandledby msgid "Handled by" msgstr "Obslouženo" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbydebugger msgid "Handled by Debugger" msgstr "Obslouženo ladícím nástrojem" #: lazarusidestrconsts.lisdebugoptionsfrmhandledbyprogram msgid "Handled by Program" msgstr "Obslouženo programem" #: lazarusidestrconsts.lisdebugoptionsfrmid msgid "ID" msgstr "ID" #: lazarusidestrconsts.lisdebugoptionsfrmignoretheseexceptions msgid "Ignore these exceptions" msgstr "Ignorovat tyto vyjímky" #: lazarusidestrconsts.lisdebugoptionsfrminterface msgid "Interface" msgstr "Rozhraní" #: lazarusidestrconsts.lisdebugoptionsfrmlanguageexceptions msgid "Language Exceptions" msgstr "Vyjímky jazyku" #: lazarusidestrconsts.lisdebugoptionsfrmlimitlinecountto msgid "Limit linecount to" msgstr "Omezit počet řádek na" #: lazarusidestrconsts.lisdebugoptionsfrmmodule msgid "Module" msgstr "Modul" #: lazarusidestrconsts.lisdebugoptionsfrmname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts.lisdebugoptionsfrmnotifyonlazarusexceptions msgid "Notify on Lazarus Exceptions" msgstr "" #: lazarusidestrconsts.lisdebugoptionsfrmosexceptions msgid "OS Exceptions" msgstr "Vyjímky OS" #: lazarusidestrconsts.lisdebugoptionsfrmoutput msgid "Output" msgstr "Výstup" #: lazarusidestrconsts.lisdebugoptionsfrmprocess msgid "Process" msgstr "Proces" #: lazarusidestrconsts.lisdebugoptionsfrmresume msgid "Resume" msgstr "Obnovit" #: lazarusidestrconsts.lisdebugoptionsfrmresumehandled msgid "Resume Handled" msgstr "Obnovit jako obsloužené" #: lazarusidestrconsts.lisdebugoptionsfrmresumeunhandled msgid "Resume Unhandled" msgstr "Obnovit jako neobsloužené" #: lazarusidestrconsts.lisdebugoptionsfrmshowmessageonstop msgid "Show message on stop" msgstr "Zobrazit hlášení při zastavení" #: lazarusidestrconsts.lisdebugoptionsfrmsignals msgid "Signals" msgstr "Signály" #: lazarusidestrconsts.lisdebugoptionsfrmthread msgid "Thread" msgstr "Vlákno" #: lazarusidestrconsts.lisdebugoptionsfrmwindow msgid "Window" msgstr "Okno" #: lazarusidestrconsts.lisdebugunabletoloadfile msgid "Unable to load file" msgstr "Nelze načíst soubor" #: lazarusidestrconsts.lisdebugunabletoloadfile2 msgid "Unable to load file %s%s%s." msgstr "Nelze načíst soubor %s%s%s." #: lazarusidestrconsts.lisdecimal msgid "Decimal" msgstr "Číselný" #: lazarusidestrconsts.lisdefaultvalue msgid "Default value" msgstr "" #: lazarusidestrconsts.lisdeleteall msgid "&Delete All" msgstr "Smazat vše" #: lazarusidestrconsts.lisdeleteallbreakpoints msgid "Delete all breakpoints?" msgstr "Smazat všechny body přerušení?" #: lazarusidestrconsts.lisdeleteallbreakpoints2 msgid "Delete all breakpoints in file %s%s%s?" msgstr "Smazat všechny body přerušení v souboru %s%s%s?" #: lazarusidestrconsts.lisdeleteallinsamesource msgid "Delete All in same source" msgstr "Smazat vše ve stejném zdroji" #: lazarusidestrconsts.lisdeleteallselectedbreakpoints msgid "Delete all selected breakpoints?" msgstr "Odebrat všechny vybrané body přerušení?" #: lazarusidestrconsts.lisdeleteallthesefiles msgid "Delete all these files?" msgstr "Odstranit všechny tyto soubory?" #: lazarusidestrconsts.lisdeleteambiguousfile msgid "Delete ambiguous file?" msgstr "Odstranit nejednoznačný soubor?" #: lazarusidestrconsts.lisdeletebreakpointatline msgid "Delete breakpoint at%s\"%s\" line %d?" msgstr "Smazat bod přerušení na%s\"%s\"řádku %d?" #: lazarusidestrconsts.lisdeletebuildmode msgid "Delete build mode %s%s%s?" msgstr "" #: lazarusidestrconsts.lisdeletefilefailed msgid "Delete file failed" msgstr "Odstranění souboru selhalo" #: lazarusidestrconsts.lisdeleteoldfile msgid "Delete old file %s%s%s?" msgstr "Odstranit starý soubor %s%s%s?" #: lazarusidestrconsts.lisdeleteoldfile2 msgid "Delete old file?" msgstr "Smazat starý soubor?" #: lazarusidestrconsts.lisdeleteselectedfiles msgid "Delete selected files" msgstr "Smazat vybrané soubory" #: lazarusidestrconsts.lisdeletevalue msgid "Delete value %s%s%s" msgstr "" #: lazarusidestrconsts.lisdeletingoffilefailed msgid "Deleting of file %s%s%s failed." msgstr "Odstranění souboru %s%s%s selhalo." #: lazarusidestrconsts.lisdelphi msgid "Delphi" msgstr "Delphi" #: lazarusidestrconsts.lisdelphiproject msgid "Delphi project" msgstr "Projekt Delphi" #: lazarusidestrconsts.lisdesthereisalreadyanothercomponentwiththename msgid "There is already another component with the name %s%s%s." msgstr "Již existuje jiná komponenta se stejným jménem %s%s%s." #: lazarusidestrconsts.lisdestinationdirectory msgid "Destination directory" msgstr "Cílová složka" #: lazarusidestrconsts.lisdestinationdirectoryisinvalidpleasechooseacomplete msgid "Destination directory %s%s%s is invalid.%sPlease choose a complete path." msgstr "Cílová složka %s%s%s je neplatná.%sProsím vyberte a celou cestu." #: lazarusidestrconsts.lisdestructorcode msgid "Destructor code" msgstr "" #: lazarusidestrconsts.lisdiffdlgcaseinsensitive msgid "Case Insensitive" msgstr "Nerozlišovat velikost znaků" #: lazarusidestrconsts.lisdiffdlgignoreifemptylineswereadd msgid "Ignore if empty lines were added or removed" msgstr "" #: lazarusidestrconsts.lisdiffdlgignoreiflineendcharsdiffe msgid "Ignore difference in line ends (e.g. #10 = #13#10)" msgstr "" #: lazarusidestrconsts.lisdiffdlgignoreifspacecharswereadd msgid "Ignore amount of space chars" msgstr "" #: lazarusidestrconsts.lisdiffdlgignorespaces msgid "Ignore spaces (newline chars not included)" msgstr "" #: lazarusidestrconsts.lisdiffdlgignorespacesatendofline msgid "Ignore spaces at end of line" msgstr "" #: lazarusidestrconsts.lisdiffdlgignorespacesatstartofline msgid "Ignore spaces at start of line" msgstr "" #: lazarusidestrconsts.lisdiffdlgonlyselection msgid "Only selection" msgstr "Pouze výběr" #: lazarusidestrconsts.lisdiffdlgopendiffineditor msgid "Open Diff in editor" msgstr "Otevřít Diff v editoru" #: lazarusidestrconsts.lisdiffdlgtext1 msgid "Text1" msgstr "Text1" #: lazarusidestrconsts.lisdiffdlgtext2 msgid "Text2" msgstr "Text2" #: lazarusidestrconsts.lisdigits msgid "Digits:" msgstr "Cifry:" #: lazarusidestrconsts.lisdirectives msgid "Directives" msgstr "Pokyny" #: lazarusidestrconsts.lisdisableallinsamesource msgid "Disable All in same source" msgstr "Zakázat vše ve stejném zdroji" #: lazarusidestrconsts.lisdisabled msgid "Disabled" msgstr "Zakázáno" #: lazarusidestrconsts.lisdisablegroup msgid "Disable Group" msgstr "Zakáza skupinu" #: lazarusidestrconsts.lisdiscardchanges msgid "Discard changes" msgstr "Zahodit změny" #: lazarusidestrconsts.lisdiskdiffchangedfiles msgid "Changed files:" msgstr "Změněné soubory:..." #: lazarusidestrconsts.lisdiskdiffclickononeoftheaboveitemstoseethediff msgid "Click on one of the above items to see the diff" msgstr "Ke zobrazení rozdílu klikněte na jednu z položek nahoře" #: lazarusidestrconsts.lisdiskdifferrorreadingfile msgid "Error reading file: %s" msgstr "Chyba načítání souboru: %s" #: lazarusidestrconsts.lisdiskdiffignorediskchanges msgid "Ignore disk changes" msgstr "" #: lazarusidestrconsts.lisdiskdiffrevertall msgid "Reload from disk" msgstr "Znovu načíst z disku" #: lazarusidestrconsts.lisdiskdiffsomefileshavechangedondisk msgid "Some files have changed on disk:" msgstr "Některé soubory se na disku změnily:" #: lazarusidestrconsts.lisdistinguishbigandsmalllettersegaanda msgid "Distinguish big and small letters e.g. A and a" msgstr "Rozlišovat velká a malá písmena např. A a a" #: lazarusidestrconsts.lisdocumentationeditor msgid "Documentation Editor" msgstr "Editor dokumentace" #: lazarusidestrconsts.lisdoesnotexists msgid "%s does not exists: %s" msgstr "%s neexistuje: %s" #: lazarusidestrconsts.lisdonotclosetheide msgid "Do not close the IDE" msgstr "Nezavírat IDE" #: lazarusidestrconsts.lisdonotclosetheproject msgid "Do not close the project" msgstr "Nezavírat projekt" #: lazarusidestrconsts.lisdonotcompiledependencies msgid "do not compile dependencies" msgstr "nepřekládat závislosti" #: lazarusidestrconsts.lisdonotshowsplashscreen msgid "Do not show splash screen" msgstr "Nezobrazovat úvodní obrázek při startu" #: lazarusidestrconsts.lisdrawgridlinesobjectinspector msgid "Draw grid lines" msgstr "Kreslit čáry mřížky" #: lazarusidestrconsts.lisdsgcopycomponents msgid "Copy selected components to clipboard" msgstr "Zkopírovat vybrané komponenty do schránky" #: lazarusidestrconsts.lisdsgcutcomponents msgid "Cut selected components to clipboard" msgstr "Výjmout vybrané komponenty do schránky" #: lazarusidestrconsts.lisdsgorderbackone msgid "Move component one back" msgstr "Přesunout komponentu o jedno dozadu" #: lazarusidestrconsts.lisdsgorderforwardone msgid "Move component one forward" msgstr "Přesunout komponentru o jedno dopředu" #: lazarusidestrconsts.lisdsgordermovetoback msgid "Move component to back" msgstr "Přesunout komponentu dozadu" #: lazarusidestrconsts.lisdsgordermovetofront msgid "Move component to front" msgstr "Přesunout komponentu dopředu" #: lazarusidestrconsts.lisdsgpastecomponents msgid "Paste selected components from clipboard" msgstr "Vložit vybrané komponenty ze schránky" #: lazarusidestrconsts.lisdsgselectparentcomponent msgid "Select parent component" msgstr "Vybrat rodičovskou komponentu" #: lazarusidestrconsts.lisduplicatefoundofvalue msgid "Duplicate found of value %s%s%s." msgstr "" #: lazarusidestrconsts.lisduplicatenameacomponentnamedalreadyexistsintheinhe msgid "Duplicate name: A component named %s%s%s already exists in the inherited component %s" msgstr "Zdvojené jméno: Komponenta pojmenovaná %s%s%s již existuje ve zděděné komponentě %s" #: lazarusidestrconsts.liseditcontexthelp msgid "Edit context help" msgstr "Upravit kontextovou nápovědu" #: lazarusidestrconsts.lisedoptschoosescheme msgid "Choose Scheme" msgstr "Vyberte schéma" #: lazarusidestrconsts.lisedtdefallpackages msgid "All packages" msgstr "Všechny balíčky" #: lazarusidestrconsts.lisedtdefcurrentproject msgid "Current Project" msgstr "Aktuální projekt" #: lazarusidestrconsts.lisedtdefcurrentprojectdirectory msgid "Current Project Directory" msgstr "Aktuální adresář projektů" #: lazarusidestrconsts.lisedtdefglobalsourcepathaddition msgid "Global Source Path addition" msgstr "" #: lazarusidestrconsts.lisedtdefprojectincpath msgid "Project IncPath" msgstr "" #: lazarusidestrconsts.lisedtdefprojectsrcpath msgid "Project SrcPath" msgstr "" #: lazarusidestrconsts.lisedtdefprojectunitpath msgid "Project UnitPath" msgstr "" #: lazarusidestrconsts.lisedtdefsallprojects msgid "All projects" msgstr "Všechny projekty" #: lazarusidestrconsts.lisedtdefsetfpcmodetodelphi msgid "set FPC mode to DELPHI" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetofpc msgid "set FPC mode to FPC" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetogpc msgid "set FPC mode to GPC" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetomacpas msgid "set FPC mode to MacPas" msgstr "" #: lazarusidestrconsts.lisedtdefsetfpcmodetotp msgid "set FPC mode to TP" msgstr "" #: lazarusidestrconsts.lisedtdefsetiocheckson msgid "set IOCHECKS on" msgstr "" #: lazarusidestrconsts.lisedtdefsetoverflowcheckson msgid "set OVERFLOWCHECKS on" msgstr "" #: lazarusidestrconsts.lisedtdefsetrangecheckson msgid "set RANGECHECKS on" msgstr "" #: lazarusidestrconsts.lisedtdefuseheaptrcunit msgid "use HeapTrc unit" msgstr "použít jednotku HeapTrc" #: lazarusidestrconsts.lisedtdefuselineinfounit msgid "use LineInfo unit" msgstr "použít jednotku LineInfo" #: lazarusidestrconsts.lisedtexttoolalt msgid "Alt" msgstr "Alt" #: lazarusidestrconsts.lisedtexttoolavalidtoolneedsatleastatitleandafilename msgid "A valid tool needs at least a title and a filename." msgstr "Platné nástroje potřebují alespoň titulek a jméno souboru." #: lazarusidestrconsts.lisedtexttoolctrl msgid "Ctrl" msgstr "Ctrl" #: lazarusidestrconsts.lisedtexttooledittool msgid "Edit Tool" msgstr "Nástroj pro úpravy" #: lazarusidestrconsts.lisedtexttoolinsert msgid "Insert" msgstr "Vložit" #: lazarusidestrconsts.lisedtexttoolkey msgid "Key" msgstr "Klávesa" #: lazarusidestrconsts.lisedtexttoolmacros msgid "Macros" msgstr "Makra" #: lazarusidestrconsts.lisedtexttoolparameters msgid "Parameters:" msgstr "Parametry:" #: lazarusidestrconsts.lisedtexttoolprogramfilename msgid "Program Filename:" msgstr "Jméno souboru programu:" #: lazarusidestrconsts.lisedtexttoolscanoutputforfreepascalcompilermessages msgid "Scan output for Free Pascal Compiler messages" msgstr "" #: lazarusidestrconsts.lisedtexttoolscanoutputformakemessages msgid "Scan output for make messages" msgstr "" #: lazarusidestrconsts.lisedtexttoolshift msgid "Shift" msgstr "Shift" #: lazarusidestrconsts.lisedtexttooltitleandfilenamerequired msgid "Title and Filename required" msgstr "Požadováno název a jméno souboru" #: lazarusidestrconsts.lisedtexttoolworkingdirectory msgid "Working Directory:" msgstr "Pracovní složka:" #: lazarusidestrconsts.lisemdall msgid "All" msgstr "Všechno" #: lazarusidestrconsts.lisemdemtpymethods msgid "Emtpy Methods" msgstr "Prázdné metody" #: lazarusidestrconsts.lisemdfoundemptymethods msgid "Found empty methods:" msgstr "Nalezeny prázdné metody:" #: lazarusidestrconsts.lisemdonlypublished msgid "Only published" msgstr "Pouze zveřejněné" #: lazarusidestrconsts.lisemdpublic msgid "Public" msgstr "Veřejný" #: lazarusidestrconsts.lisemdpublished msgid "Published" msgstr "Zveřejněné" #: lazarusidestrconsts.lisemdremovemethods msgid "Remove methods" msgstr "Odstranit metody" #: lazarusidestrconsts.lisemdsearchintheseclasssections msgid "Search in these class sections:" msgstr "" #: lazarusidestrconsts.lisenableall msgid "&Enable All" msgstr "&Editovat vše" #: lazarusidestrconsts.lisenableallinsamesource msgid "Enable All in same source" msgstr "Povolit vše ve stejném zdroji" #: lazarusidestrconsts.lisenabled msgid "Enabled" msgstr "Povolený" #: lazarusidestrconsts.lisenablegroup msgid "Enable Group" msgstr "Povolit skupinu" #: lazarusidestrconsts.lisenablemacros msgid "Enable Macros" msgstr "Povolit makra" #: lazarusidestrconsts.lisenclose msgid "Enclose" msgstr "" #: lazarusidestrconsts.lisencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisencodingoffileondiskisnewencodingis2 msgid "Encoding of file %s%s%s%son disk is %s. New encoding is %s." msgstr "" #: lazarusidestrconsts.lisentertransla msgid "Enter translation language" msgstr "Zadejte překladový jazyk" #: lazarusidestrconsts.lisenvdoubleclickonmessagesjumpsotherwisesingleclick msgid "Double click on messages jumps (otherwise: single click)" msgstr "Dvojklikna zprávu skočí na umístění (jinak: jeden klik)" #: lazarusidestrconsts.lisenvironmentvariablenameasparameter msgid "Environment variable, name as parameter" msgstr "" #: lazarusidestrconsts.lisenvoptdlgdirectorynotfound msgid "Directory not found" msgstr "Složka nenalezena" #: lazarusidestrconsts.lisenvoptdlgfpcsrcdirnotfoundmsg msgid "FPC source directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilename msgid "Invalid compiler filename" msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidcompilerfilenamemsg msgid "The compiler file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilename msgid "Invalid debugger filename" msgstr "" #: lazarusidestrconsts.lisenvoptdlginvaliddebuggerfilenamemsg msgid "The debugger file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidfpcsrcdir msgid "The FPC source directory \"%s\" does not look correct. Normally it contains directories like rtl, packages, compiler, ... ." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidlazarusdir msgid "The lazarus directory \"%s\" does not look correct. Normally it contains directories like lcl, debugger, designer, components, ... ." msgstr "" #: lazarusidestrconsts.lisenvoptdlginvalidmakefilename msgid "Invalid make filename" msgstr "Neplatné jméno make" #: lazarusidestrconsts.lisenvoptdlginvalidmakefilenamemsg msgid "The make file \"%s\" is not an executable." msgstr "" #: lazarusidestrconsts.lisenvoptdlglazarusdirnotfoundmsg msgid "Lazarus directory \"%s\" not found." msgstr "" #: lazarusidestrconsts.lisenvoptdlgtestdirnotfoundmsg msgid "Test directory \"%s\" not found." msgstr "Testovací složka \"%s\" nenalezena." #: lazarusidestrconsts.liseonoteonlyabsolutepathsaresupportednow msgid "NOTE: only absolute paths are supported now" msgstr "POZNÁMKA: nyní jsou podporovány pouze plné cesty" #: lazarusidestrconsts.liseotabwidths msgid "Tab widths" msgstr "Šířka odsazení" #: lazarusidestrconsts.liserrinvalidoption msgid "Invalid option at position %d: \"%s\"" msgstr "Nesprávná volba na pozici %d: \"%s\"" #: lazarusidestrconsts.liserrnooptionallowed msgid "Option at position %d does not allow an argument: %s" msgstr "Volba na pozici %d nepovoluje argument: %s" #: lazarusidestrconsts.liserroptionneeded msgid "Option at position %d needs an argument : %s" msgstr "Volba na pozici %d potřebuje argument : %s" #: lazarusidestrconsts.liserror msgid "Error: " msgstr "Chyba:" #: lazarusidestrconsts.liserrorcreatingfile msgid "Error creating file" msgstr "Chyba vytváření souboru" #: lazarusidestrconsts.liserrorcreatinglrs msgid "Error creating lrs" msgstr "Chyba vytváření lrs" #: lazarusidestrconsts.liserrordeletingfile msgid "Error deleting file" msgstr "Chyba mazání souboru" #: lazarusidestrconsts.liserrorin msgid "Error in %s" msgstr "Chyba v %s" #: lazarusidestrconsts.liserrorinitializingprogramserrors msgid "Error initializing program%s%s%s%s%sError: %s" msgstr "Chyba inicializace programu%s%s%s%s%sChyba: %s" #: lazarusidestrconsts.liserrorloadingfile msgid "Error loading file" msgstr "Chyba načítání souboru" #: lazarusidestrconsts.liserrorloadingfrom msgid "Error loading %s from%s%s%s%s" msgstr "Chyba načítání %s z%s%s%s%s" #: lazarusidestrconsts.liserrormovingcomponent msgid "Error moving component" msgstr "Chyba přesunu komponenty" #: lazarusidestrconsts.liserrormovingcomponent2 msgid "Error moving component %s:%s" msgstr "Chyba přesunu komponenty %s:%s" #: lazarusidestrconsts.liserroropeningcomponent msgid "Error opening component" msgstr "Chyba otevírání komponenty" #: lazarusidestrconsts.liserrorparsinglfmcomponentstream msgid "Error parsing lfm component stream." msgstr "Chyba analýzy komponentového proudu lfm." #: lazarusidestrconsts.liserrorreadingpackagelistfromfile msgid "Error reading package list from file%s%s%s%s" msgstr "Chyba načítání seznamu balíčků ze souboru%s%s%s%s" #: lazarusidestrconsts.liserrorreadingxml msgid "Error reading XML" msgstr "Chyba načítání XML" #: lazarusidestrconsts.liserrorreadingxmlfile msgid "Error reading xml file %s%s%s%s%s" msgstr "Chyba čtení xml souboru %s%s%s%s" #: lazarusidestrconsts.liserrorrenamingfile msgid "Error renaming file" msgstr "Chyba přejmenování souboru" #: lazarusidestrconsts.liserrors msgid "Errors" msgstr "Chyby" #: lazarusidestrconsts.liserrorsavingto msgid "Error saving %s to%s%s%s%s" msgstr "Cyba ukládání %s do %s%s%s%s" #: lazarusidestrconsts.liserrorwritingpackagelisttofile msgid "Error writing package list to file%s%s%s%s" msgstr "Cyba zápisu seznamu balíčků do souboru%s%s%s%s" #: lazarusidestrconsts.liseteditcustomscanners msgid "Edit custom scanners (%s)" msgstr "Upravit vlastní prohledávače (%s)" #: lazarusidestrconsts.liseverynthlinenumber msgid "Every n-th line number:" msgstr "Každé n-té číslo řádku:" #: lazarusidestrconsts.lisexamples msgid "Examples" msgstr "Příklady" #: lazarusidestrconsts.lisexamplesidentifiertmyenumenumunitnameidentifierpac msgid "Examples:%sIdentifier%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" msgstr "Příklady:%sIdentifikátor%sTMyEnum.Enum%sUnitname.Identifier%s#PackageName.UnitName.Identifier" #: lazarusidestrconsts.lisexceptiondialog msgid "Debugger Exception Notification" msgstr "" #: lazarusidestrconsts.lisexcludefilter msgid "Exclude Filter" msgstr "Filtr vyřazení" #: lazarusidestrconsts.lisexcludefilter2 msgid "Exclude filter" msgstr "Filtr vyřazení" #: lazarusidestrconsts.lisexecutingcommandafter msgid "Executing command after" msgstr "" #: lazarusidestrconsts.lisexecutingcommandbefore msgid "Executing command before" msgstr "" #: lazarusidestrconsts.lisexecutionpaused msgid "Execution paused" msgstr "" #: lazarusidestrconsts.lisexecutionpausedadress msgid "Execution paused%s Adress: $%s%s Procedure: %s%s File: %s%s(Some day an assembler window might popup here :)%s" msgstr "" #: lazarusidestrconsts.lisexecutionstopped msgid "Execution stopped" msgstr "" #: lazarusidestrconsts.lisexecutionstoppedon msgid "Execution stopped%s" msgstr "" #: lazarusidestrconsts.lisexeprograms msgid "Programs" msgstr "Programy" #: lazarusidestrconsts.lisexpandallclasses msgid "Expand all classes" msgstr "" #: lazarusidestrconsts.lisexpandallpackages msgid "Expand all packages" msgstr "" #: lazarusidestrconsts.lisexpandallunits msgid "Expand all units" msgstr "" #: lazarusidestrconsts.lisexpandedfilenameofcurrenteditor msgid "Expanded filename of current editor file" msgstr "" #: lazarusidestrconsts.lisexport msgid "Export ..." msgstr "Exportovat..." #: lazarusidestrconsts.lisexportlist msgid "Export list" msgstr "" #: lazarusidestrconsts.lisexpression msgid "Expression:" msgstr "Výraz:" #: lazarusidestrconsts.lisextendunitpath msgid "Extend unit path?" msgstr "" #: lazarusidestrconsts.lisextract msgid "Extract" msgstr "" #: lazarusidestrconsts.lisextractprocedure msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts.lisexttoolexternaltools msgid "External tools" msgstr "" #: lazarusidestrconsts.lisexttoolfailedtoruntool msgid "Failed to run tool" msgstr "Nelze spustit nástroj" #: lazarusidestrconsts.lisexttoolmaximumtoolsreached msgid "Maximum Tools reached" msgstr "" #: lazarusidestrconsts.lisexttoolmovedown msgid "Down" msgstr "Dolů" #: lazarusidestrconsts.lisexttoolmoveup msgid "Up" msgstr "Nahoru" #: lazarusidestrconsts.lisexttoolremove msgid "Remove" msgstr "Odstranit" #: lazarusidestrconsts.lisexttoolthereisamaximumoftools msgid "There is a maximum of %s tools." msgstr "Toto je maximální počet nástrojů %s." #: lazarusidestrconsts.lisexttooltitlecompleted msgid "\"%s\" completed" msgstr "\"%s\" hotovo" #: lazarusidestrconsts.lisexttoolunabletorunthetool msgid "Unable to run the tool %s%s%s:%s%s" msgstr "Nelze spustit nástroj %s%s%s:%s%s" #: lazarusidestrconsts.lisfepaintdesigneritemsonidle msgid "Reduce designer painting" msgstr "" #: lazarusidestrconsts.lisfepaintdesigneritemsonidlereduceoverheadforslowcompu msgid "Paint designer items only on idle (reduce overhead for slow computers)" msgstr "" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?" #: lazarusidestrconsts.lisfiledoesnotlooklikeatextfileopenitanyway2 msgid "File %s%s%s%sdoes not look like a text file.%sOpen it anyway?" msgstr "Soubor %s%s%s%snevypadá jako textový soubor.%sPřesto otevřít?" #: lazarusidestrconsts.lisfileextensionofprograms msgid "File extension of programs" msgstr "Přípona souboru programu" #: lazarusidestrconsts.lisfilefilter msgid "File filter" msgstr "" #: lazarusidestrconsts.lisfilehaschangedsave msgid "File %s%s%s has changed. Save?" msgstr "Soubor %s%s%s byl pozměněn. Uložit?" #: lazarusidestrconsts.lisfileisnotwritable msgid "File is not writable" msgstr "Soubor není zapisovatelný" #: lazarusidestrconsts.lisfileissymlink msgid "File is symlink" msgstr "Soubor je symbolický odkaz" #: lazarusidestrconsts.lisfileisvirtual msgid "File %s%s%s is virtual." msgstr "Soubor %s%s%s je virtuální." #: lazarusidestrconsts.lisfilelinkerror msgid "File link error" msgstr "Chyba vazby souboru" #: lazarusidestrconsts.lisfilenameaddress msgid "Filename/Address" msgstr "Jméno souboru/Adresa" #: lazarusidestrconsts.lisfilenotfound msgid "File not found" msgstr "Soubor nenalezen" #: lazarusidestrconsts.lisfilenotfound2 msgid "File %s%s%s not found.%s" msgstr "Soubor %s%s%s nenalezen.%s" #: lazarusidestrconsts.lisfilenotfounddoyouwanttocreateit msgid "File %s%s%s not found.%sDo you want to create it?%s" msgstr "Soubor %s%s%s nenalezen.%sChcete jej vytvořit?%s" #: lazarusidestrconsts.lisfilenotlowercase msgid "File not lowercase" msgstr "Soubor není s malými písmeny" #: lazarusidestrconsts.lisfilenottext msgid "File not text" msgstr "Soubor není textový" #: lazarusidestrconsts.lisfilesettings msgid "File Settings ..." msgstr "Nastavení souboru..." #: lazarusidestrconsts.lisfilesinasciiorutf8encoding msgid "Files in ASCII or UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilesnotinasciinorutf8encoding msgid "Files not in ASCII nor UTF-8 encoding" msgstr "" #: lazarusidestrconsts.lisfilewheredebugoutputiswritten msgid "file, where debug output is written to. If it is not specified, debug output is written to the console." msgstr "soubor, kam je zapisován ladící výstup. Pokud není uveden, ladící výstup je vypisován do konzoly." #: lazarusidestrconsts.lisfilter msgid "Filter" msgstr "Filtr" #: lazarusidestrconsts.lisfilter2 msgid "(filter)" msgstr "(filtr)" #: lazarusidestrconsts.lisfiltersets msgid "Filter Sets" msgstr "" #: lazarusidestrconsts.lisfindfilecasesensitive msgid "&Case sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts.lisfindfiledirectoryoptions msgid "Directory options" msgstr "Nastavení složky" #: lazarusidestrconsts.lisfindfilefilemaskbak msgid "File mask (*;*.*;*.bak?)" msgstr "Maska souboru (*;*.*;*.bak?)" #: lazarusidestrconsts.lisfindfileincludesubdirectories msgid "Include sub directories" msgstr "" #: lazarusidestrconsts.lisfindfilemultilinepattern msgid "&Multiline pattern" msgstr "&Víceřádkový vzor" #: lazarusidestrconsts.lisfindfileonlytextfiles msgid "Only text files" msgstr "Pouze textové soubory" #: lazarusidestrconsts.lisfindfileregularexpressions msgid "&Regular expressions" msgstr "&Regulární výrazy" #: lazarusidestrconsts.lisfindfilesearchallfilesinproject msgid "search all files in &project" msgstr "" #: lazarusidestrconsts.lisfindfilesearchallopenfiles msgid "search all &open files" msgstr "" #: lazarusidestrconsts.lisfindfilesearchindirectories msgid "search in &directories" msgstr "" #: lazarusidestrconsts.lisfindfiletexttofind msgid "Text to find:" msgstr "Text k nalezení:" #: lazarusidestrconsts.lisfindfilewhere msgid "Where" msgstr "Kde" #: lazarusidestrconsts.lisfindfilewholewordsonly msgid "&Whole words only" msgstr "&Pouze celková slova" #: lazarusidestrconsts.lisfindkeycombination msgid "Find key combination" msgstr "Najít kombinaci kláves" #: lazarusidestrconsts.lisfirst msgid "First" msgstr "" #: lazarusidestrconsts.lisfixlfmfile msgid "Fix LFM file" msgstr "" #: lazarusidestrconsts.lisfloatingpoin msgid "Floating Point" msgstr "Plovoucí čárka" #: lazarusidestrconsts.lisforcerenaming msgid "Force renaming" msgstr "Vynutit přejmenování" #: lazarusidestrconsts.lisformaterror msgid "Format error" msgstr "Chyba formátování" #: lazarusidestrconsts.lisformloaderror msgid "Form load error" msgstr "Chyba načtení formuláře" #: lazarusidestrconsts.lisfpcmakefailed msgid "fpcmake failed" msgstr "" #: lazarusidestrconsts.lisfpcomponents msgid "Components" msgstr "Komponenty" #: lazarusidestrconsts.lisfpcsourcedirectoryerror msgid "FPC Source Directory error" msgstr "" #: lazarusidestrconsts.lisfpcversion msgid "FPC Version: " msgstr "Verze FPC:" #: lazarusidestrconsts.lisfpcversioneg222 msgid "FPC Version (e.g. 2.2.2)" msgstr "Verze FPC (např. 2.2.2)" #: lazarusidestrconsts.lisfpdoceditor msgid "FPDoc Editor" msgstr "" #: lazarusidestrconsts.lisfpfindpalettecomponent msgid "Find palette component" msgstr "" #: lazarusidestrconsts.lisfrbackwardsearch msgid "&Backward search" msgstr "&Hledat pozpátku" #: lazarusidestrconsts.lisfreepascal msgid "Free Pascal" msgstr "Free Pascal" #: lazarusidestrconsts.lisfreepascalcompilernotfound msgid "Free Pascal Compiler not found" msgstr "" #: lazarusidestrconsts.lisfreepascalprogramusingtcustomapplicationtoeasilych msgid "freepascal program using TCustomApplication to easily check command line options, handling exceptions, etc. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts.lisfreepascalsourcedirectory msgid "Freepascal source directory" msgstr "Zdrojová složka Freepascalu" #: lazarusidestrconsts.lisfreepascalsourcefile msgid "FreePascal source file" msgstr "Zdrojový soubor Free Pascalu" #: lazarusidestrconsts.lisfreepascalsourcesnotfound msgid "Free Pascal Sources not found" msgstr "" #: lazarusidestrconsts.lisfrforwardsearch msgid "Forwar&d search" msgstr "Hleda&t dopředu" #: lazarusidestrconsts.lisfriadditionalfilestosearchegpathpaspath2pp msgid "Additional files to search (e.g. /path/*.pas;/path2/*.pp)" msgstr "Doplňující soubory k vyhledání (napč. /path/*.pas;/path2/*.pp)" #: lazarusidestrconsts.lisfrifindorrenameidentifier msgid "Find or Rename Identifier" msgstr "" #: lazarusidestrconsts.lisfrifindreferences msgid "Find References" msgstr "Najít odkazy" #: lazarusidestrconsts.lisfriidentifier msgid "Identifier: %s" msgstr "Identifikátor: %s" #: lazarusidestrconsts.lisfriinallopenpackagesandprojects msgid "in all open packages and projects" msgstr "" #: lazarusidestrconsts.lisfriincurrentunit msgid "in current unit" msgstr "v aktuální jednotce" #: lazarusidestrconsts.lisfriinmainproject msgid "in main project" msgstr "v hlavním projektu" #: lazarusidestrconsts.lisfriinprojectpackageowningcurrentunit msgid "in project/package owning current unit" msgstr "" #: lazarusidestrconsts.lisfriinvalididentifier msgid "Invalid Identifier" msgstr "Neplatný identifikátor" #: lazarusidestrconsts.lisfrirename msgid "Rename" msgstr "Přejmenování" #: lazarusidestrconsts.lisfrirenameallreferences msgid "Rename all References" msgstr "Přejmenovat všechny výskyty" #: lazarusidestrconsts.lisfrirenameto msgid "Rename to" msgstr "Přejmenovat na" #: lazarusidestrconsts.lisfrisearchincommentstoo msgid "Search in comments too" msgstr "Hledat také v komentářích" #: lazarusidestrconsts.lisfrisearchwhere msgid "Search where" msgstr "Kde hledat" #: lazarusidestrconsts.lisfunction msgid "Function" msgstr "Funkce" #: lazarusidestrconsts.lisgplnotice msgid "%sCopyright (C) %sThis source is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis code is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. %sA copy of the GNU General Public License is available on the World Wide Web at . You can also obtain it by writing to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lisgroup msgid "Group" msgstr "Skupina" #: lazarusidestrconsts.lisgrowtolarges msgid "Grow to Largest" msgstr "Narůst na největší" #: lazarusidestrconsts.lishashelp msgid "Has Help" msgstr "" #: lazarusidestrconsts.lisheadercommentforclass msgid "Header comment for class" msgstr "" #: lazarusidestrconsts.lishelpentries msgid "Help entries" msgstr "" #: lazarusidestrconsts.lishelpselectordialog msgid "Help selector" msgstr "" #: lazarusidestrconsts.lishexadecimal msgid "Hexadecimal" msgstr "Šestnáctkový" #: lazarusidestrconsts.lishfmhelpforfreepascalcompilermessage msgid "Help for FreePascal Compiler message" msgstr "Nápověda pro zprávy překladače FreePascalu" #: lazarusidestrconsts.lishintcheckiftwopackagescontainaunitwiththesamename msgid "Hint: Check if two packages contain a unit with the same name." msgstr "" #: lazarusidestrconsts.lishintopen msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts.lishintpause msgid "Pause" msgstr "Pozastavit" #: lazarusidestrconsts.lishintrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts.lishintsave msgid "Save" msgstr "Uložit" #: lazarusidestrconsts.lishintsaveall msgid "Save all" msgstr "Uložit vše" #: lazarusidestrconsts.lishintstepinto msgid "Step Into" msgstr "Vejít do" #: lazarusidestrconsts.lishintstepover msgid "Step Over" msgstr "Přejít přes" #: lazarusidestrconsts.lishintstop msgid "Stop" msgstr "" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select the expression and try again." msgstr "" #: lazarusidestrconsts.lishintthemakeresourcestringfunctionexpectsastringcon2 msgid "Hint: The \"Make Resourcestring\" function expects a string constant.%sPlease select only a string expression and try again." msgstr "" #: lazarusidestrconsts.lishinttoggleformunit msgid "Toggle Form/Unit" msgstr "Přepni Formulář/Jednotka" #: lazarusidestrconsts.lishintviewforms msgid "View Forms" msgstr "Zobrazit formuláře" #: lazarusidestrconsts.lishintviewunits msgid "View Units" msgstr "Zobrazit jednotky" #: lazarusidestrconsts.lishlpoptsdatabases msgid "Databases" msgstr "Databáze" #: lazarusidestrconsts.lishlpoptshelpoptions msgid "Help Options" msgstr "Volby nápovědy" #: lazarusidestrconsts.lishlpoptsproperties msgid "Properties:" msgstr "Vlastnosti:" #: lazarusidestrconsts.lishlpoptsviewers msgid "Viewers" msgstr "Zobrazovače" #: lazarusidestrconsts.lishofpcdochtmlpath msgid "FPC Doc HTML Path" msgstr "" #: lazarusidestrconsts.lishorizontal msgid "Horizontal" msgstr "Horizontální" #: lazarusidestrconsts.liside msgid "IDE" msgstr "IDE" #: lazarusidestrconsts.lisideintf msgid "IDE Interface" msgstr "" #: lazarusidestrconsts.lisidentifierbeginswith msgid "Identifier begins with ..." msgstr "Identifikátor začíná s..." #: lazarusidestrconsts.lisidentifiercontains msgid "Identifier contains ..." msgstr "Identifikátor obsahuje..." #: lazarusidestrconsts.lisideoptions msgid "IDE Options:" msgstr "Volby IDE:" #: lazarusidestrconsts.lisiecoerroraccessingxml msgid "Error accessing xml" msgstr "Chyba přistupování k xml" #: lazarusidestrconsts.lisiecoerroraccessingxmlfile msgid "Error accessing xml file %s%s%s:%s%s" msgstr "Chyba přístupu k xml souboru %s%s%s:%s%s" #: lazarusidestrconsts.lisiecoerrorloadingxml msgid "Error loading xml" msgstr "Chyba načítání xml" #: lazarusidestrconsts.lisiecoerrorloadingxmlfile msgid "Error loading xml file %s%s%s:%s%s" msgstr "Chyba načítání xml souboru %s%s%s:%s%s" #: lazarusidestrconsts.lisiecoexportfileexists msgid "Export file exists" msgstr "Exportovaný soubor existuje" #: lazarusidestrconsts.lisiecoexportfileexistsopenfileandreplaceonlycompileropti msgid "Export file %s%s%s exists.%sOpen file and replace only compiler options?%s(Other settings will be kept.)" msgstr "" #: lazarusidestrconsts.lisiecoloadfromfile msgid "Load from file" msgstr "Načíst ze souboru" #: lazarusidestrconsts.lisiecoopenorloadcompileroptions msgid "Open or Load Compiler Options" msgstr "Otevřít nebo načíst nastavení překladače" #: lazarusidestrconsts.lisiecoopenrecent msgid "Open recent" msgstr "Otevřít nedávný" #: lazarusidestrconsts.lisiecorecentfiles msgid "Recent files" msgstr "Nedávné soubory" #: lazarusidestrconsts.lisiecosavetofile msgid "Save to file" msgstr "Uložit soubor" #: lazarusidestrconsts.lisiecosavetorecent msgid "Save to recent" msgstr "Uložit do nedávných" #: lazarusidestrconsts.lisifdok msgid "OK" msgstr "OK" #: lazarusidestrconsts.lisignoreall msgid "Ignore all" msgstr "Ignorovat vše" #: lazarusidestrconsts.lisignoreandcontinue msgid "Ignore and continue" msgstr "Ignorovat a pokračovat" #: lazarusidestrconsts.lisignorebinaries msgid "Ignore binaries" msgstr "Ignorovat binární" #: lazarusidestrconsts.lisignoreexceptiontype msgid "Ignore this exception type" msgstr "" #: lazarusidestrconsts.lisignoremissingfile msgid "Ignore missing file" msgstr "" #: lazarusidestrconsts.lisignoreusetformasancestor msgid "Ignore, use TForm as ancestor" msgstr "" #: lazarusidestrconsts.lisimportlist msgid "Import list" msgstr "" #: lazarusidestrconsts.lisincludefilter msgid "Include Filter" msgstr "Filtr zahrnutí" #: lazarusidestrconsts.lisincludepath msgid "include path" msgstr "" #: lazarusidestrconsts.lisincludepaths msgid "Include paths" msgstr "Cesty pro začleněné soubory" #: lazarusidestrconsts.lisindex msgid "Index" msgstr "Index" #: lazarusidestrconsts.lisinfobuildabort msgid "Aborted..." msgstr "Přerušeno..." #: lazarusidestrconsts.lisinfobuildbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts.lisinfobuildcaption msgid "Compile Project" msgstr "Kompilovat projekt" #: lazarusidestrconsts.lisinfobuildcomplile msgid "Compiling..." msgstr "Překládání..." #: lazarusidestrconsts.lisinfobuilderror msgid "Error..." msgstr "Chyba..." #: lazarusidestrconsts.lisinfobuilderrors msgid "Errors:" msgstr "Chyby:" #: lazarusidestrconsts.lisinfobuildhint msgid "Hints:" msgstr "Pokyny:" #: lazarusidestrconsts.lisinfobuildlines msgid "Lines:" msgstr "Řádky:" #: lazarusidestrconsts.lisinfobuildmakeabort msgid "Abort" msgstr "Přerušit" #: lazarusidestrconsts.lisinfobuildnote msgid "Notes:" msgstr "Poznámky:" #: lazarusidestrconsts.lisinfobuildsuccess msgid "Success..." msgstr "Úspěch..." #: lazarusidestrconsts.lisinfobuildwarning msgid "Warnings:" msgstr "Varování:" #: lazarusidestrconsts.lisinformationaboutunit msgid "Information about %s" msgstr "Informace o %s" #: lazarusidestrconsts.lisinfrontofrelated msgid "In front of related" msgstr "" #: lazarusidestrconsts.lisinheriteditem msgid "Inherited Item" msgstr "" #: lazarusidestrconsts.lisinordertocreateacleancopyoftheprojectpackageallfil msgid "In order to create a clean copy of the project/package, all files in the following directory will be deleted and all its content will be lost.%s%sDelete all files in %s%s%s?" msgstr "" #: lazarusidestrconsts.lisinspectdata msgid "Data" msgstr "" #: lazarusidestrconsts.lisinspectdialog msgid "Debug Inspector" msgstr "" #: lazarusidestrconsts.lisinspectmethods msgid "Methods" msgstr "" #: lazarusidestrconsts.lisinspectproperties msgid "Properties" msgstr "" #: lazarusidestrconsts.lisinstallationfailed msgid "Installation failed" msgstr "Instalace selhala" #: lazarusidestrconsts.lisinstalledpackages msgid "Installed Packages" msgstr "" #: lazarusidestrconsts.lisinstallselection msgid "Install selection" msgstr "Instalovat výběr" #: lazarusidestrconsts.lisinternalname msgid "Internal Name:" msgstr "" #: lazarusidestrconsts.lisinvalidbuildmodethebuildmodemustbeapascalidentifie msgid "Invalid build mode %s%s%s. The build mode must be a pascal identifier." msgstr "" #: lazarusidestrconsts.lisinvalidcircle msgid "Invalid circle" msgstr "Neplatný kruh" #: lazarusidestrconsts.lisinvalidcommand msgid "Invalid command" msgstr "Neplatný povel" #: lazarusidestrconsts.lisinvalidcompilerfilename msgid "Invalid Compiler Filename" msgstr "" #: lazarusidestrconsts.lisinvaliddelete msgid "Invalid delete" msgstr "" #: lazarusidestrconsts.lisinvaliddestinationdirectory msgid "Invalid destination directory" msgstr "Neplatný cílový adresář" #: lazarusidestrconsts.lisinvalidexpression msgid "Invalid expression:%s%s%s%s" msgstr "Neplatný výraz:%s%s%s%s" #: lazarusidestrconsts.lisinvalidexpressionhintthemakeresourcestringfunction msgid "Invalid expression.%sHint: The \"Make Resourcestring\" function expects a string constant in a single file. Please select the expression and try again." msgstr "" #: lazarusidestrconsts.lisinvalidfilter msgid "Invalid filter" msgstr "Neplatnýá filtr" #: lazarusidestrconsts.lisinvalidfreepascalsourcedirectory msgid "Invalid Free Pascal source directory" msgstr "" #: lazarusidestrconsts.lisinvalidmultiselection msgid "Invalid multiselection" msgstr "Neplatný vícenásobný výběr" #: lazarusidestrconsts.lisinvalidoff msgid "Invalid (Off)" msgstr "Neplatný (Vypnuto)" #: lazarusidestrconsts.lisinvalidon msgid "Invalid (On)" msgstr "Neplatný (Zapnuto)" #: lazarusidestrconsts.lisinvalidpascalidentifiercap msgid "Invalid Pascal Identifier" msgstr "Neplatný Pascalovský identifikátor" #: lazarusidestrconsts.lisinvalidpascalidentifiertext msgid "The name \"%s\" is not a valid pascal identifier." msgstr "Jméno \"%s\" není platný pascalovský identifikátor." #: lazarusidestrconsts.lisinvalidprocname msgid "Invalid proc name" msgstr "" #: lazarusidestrconsts.lisinvalidprojectfilename msgid "Invalid project filename" msgstr "Neplatné jméno projektu" #: lazarusidestrconsts.lisinvalidpublishingdirectory msgid "Invalid publishing Directory" msgstr "" #: lazarusidestrconsts.lisinvalidselection msgid "Invalid selection" msgstr "Neplatný výběr" #: lazarusidestrconsts.lisisalreadypartoftheproject msgid "%s is already part of the Project." msgstr "%s už je částí projektu." #: lazarusidestrconsts.lisisaninvalidprojectnamepleasechooseanotheregproject msgid "%s%s%s is an invalid project name.%sPlease choose another (e.g. project1.lpi)" msgstr "%s%s%s je chybné jméno projektu.%sProsím vyberte jiné (např. project1.lpi)" #: lazarusidestrconsts.lisisathiscircledependencyisnotallowed msgid "%s is a %s.%sThis circle dependency is not allowed." msgstr "%s je %s.%sTakováto cyklická závislost není povolená." #: lazarusidestrconsts.lisjitform msgid "JIT Form" msgstr "" #: lazarusidestrconsts.liskeepname msgid "Keep name" msgstr "" #: lazarusidestrconsts.liskeepthemandcontinue msgid "Keep them and continue" msgstr "Ponechat je a pokračovat" #: lazarusidestrconsts.liskeycatcustom msgid "Custom commands" msgstr "Vlastní příkazy" #: lazarusidestrconsts.liskeycatdesigner msgid "Designer commands" msgstr "Povely návrháře" #: lazarusidestrconsts.liskeycatobjinspector msgid "Object Inspector commands" msgstr "Příkazy inspektoru objektů" #: lazarusidestrconsts.liskeyor2keysequence msgid "Key (or 2 key sequence)" msgstr "" #: lazarusidestrconsts.liskmabortbuilding msgid "Abort building" msgstr "Přerušit sestavování" #: lazarusidestrconsts.liskmaddactiveunittoproject msgid "Add active unit to project" msgstr "Přidat aktivní jednotku do projektu" #: lazarusidestrconsts.liskmaddwatch msgid "Add watch" msgstr "Přidat sledování" #: lazarusidestrconsts.liskmbuildallfilesofprojectprogram msgid "Build all files of project/program" msgstr "Sestavit všechny soubory projektu/programu" #: lazarusidestrconsts.liskmbuildprojectprogram msgid "Build project/program" msgstr "Sestavit projekt/program" #: lazarusidestrconsts.liskmchoosekeymappingscheme msgid "Choose Keymapping scheme" msgstr "Vyberte schéma mapování kláves" #: lazarusidestrconsts.liskmclassic msgid "Classic" msgstr "Vzor" #: lazarusidestrconsts.liskmcloseall msgid "Close All" msgstr "Zavřít vše" #: lazarusidestrconsts.liskmcloseproject msgid "Close project" msgstr "Zavřít projekt" #: lazarusidestrconsts.liskmcodetoolsdefineseditor msgid "CodeTools defines editor" msgstr "Editor definic CodeTools" #: lazarusidestrconsts.liskmcodetoolsoptions msgid "CodeTools options" msgstr "Nastavení CodeTools" #: lazarusidestrconsts.liskmcompileroptions msgid "Compiler options" msgstr "Volby překladače" #: lazarusidestrconsts.liskmconfigbuildfile msgid "Config %sBuild File%s" msgstr "Konfigurace %sSoubor sestavení %s" #: lazarusidestrconsts.liskmconfigurecustomcomponents msgid "Configure custom components" msgstr "Konfigurovat vlastní komponenty" #: lazarusidestrconsts.liskmconfigurehelp msgid "Configure Help" msgstr "Nastavit nápovědu" #: lazarusidestrconsts.liskmconfigureinstalledpackages msgid "Configure installed packages" msgstr "Konfigurovat instalované balíčky" #: lazarusidestrconsts.liskmcontextsensitivehelp msgid "Context sensitive help" msgstr "Kontextová nápověda" #: lazarusidestrconsts.liskmconvertdelphipackagetolazaruspackage msgid "Convert Delphi package to Lazarus package" msgstr "Převést Delphi balíček na Lazarus balíček" #: lazarusidestrconsts.liskmconvertdelphiprojecttolazarusproject msgid "Convert Delphi project to Lazarus project" msgstr "Převést Delphi projekt na Lazarus projekt" #: lazarusidestrconsts.liskmconvertdelphiunittolazarusunit msgid "Convert Delphi unit to Lazarus unit" msgstr "Převést Delphi jednotku na Lazarus jednotku" #: lazarusidestrconsts.liskmconvertdfmfiletolfm msgid "Convert DFM file to LFM" msgstr "Převést DFM soubor na LFM" #: lazarusidestrconsts.liskmcopyselectedcomponentstoclipboard msgid "Copy selected Components to clipboard" msgstr "Zkopírovat vybrané komponenty do schránky" #: lazarusidestrconsts.liskmcutselectedcomponentstoclipboard msgid "Cut selected Components to clipboard" msgstr "Výjmout vybrané komponenty do schránky" #: lazarusidestrconsts.liskmdeletelastchar msgid "Delete last char" msgstr "Odstranit poslední znak" #: lazarusidestrconsts.liskmdiffeditorfiles msgid "Diff editor files" msgstr "Rozdíl editovaných souborů" #: lazarusidestrconsts.liskmeditcodetemplates msgid "Edit Code Templates" msgstr "Upravit šablony kódů" #: lazarusidestrconsts.liskmeditcontextsensitivehelp msgid "Edit context sensitive help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts.liskmeditoroptions msgid "Editor options" msgstr "Nastavení editoru" #: lazarusidestrconsts.liskmencloseselection msgid "Enclose selection" msgstr "" #: lazarusidestrconsts.liskmevaluatemodify msgid "Evaluate/Modify" msgstr "Vyhodnocení/Upravení" #: lazarusidestrconsts.liskmexternaltoolssettings msgid "External Tools settings" msgstr "Nastavení vnějších nástrojů" #: lazarusidestrconsts.liskmfindincremental msgid "Find incremental" msgstr "" #: lazarusidestrconsts.liskmgotomarker0 msgid "Go to marker 0" msgstr "Jít na značku 0" #: lazarusidestrconsts.liskmgotomarker1 msgid "Go to marker 1" msgstr "Jít na značku 1" #: lazarusidestrconsts.liskmgotomarker2 msgid "Go to marker 2" msgstr "Jít na značku 2" #: lazarusidestrconsts.liskmgotomarker3 msgid "Go to marker 3" msgstr "Jít na značku 3" #: lazarusidestrconsts.liskmgotomarker4 msgid "Go to marker 4" msgstr "Jít na značku 4" #: lazarusidestrconsts.liskmgotomarker5 msgid "Go to marker 5" msgstr "Jít na značku 5" #: lazarusidestrconsts.liskmgotomarker6 msgid "Go to marker 6" msgstr "Jít na značku 6" #: lazarusidestrconsts.liskmgotomarker7 msgid "Go to marker 7" msgstr "Jít na značku 7" #: lazarusidestrconsts.liskmgotomarker8 msgid "Go to marker 8" msgstr "Jít na značku 8" #: lazarusidestrconsts.liskmgotomarker9 msgid "Go to marker 9" msgstr "Jít na značku 9" #: lazarusidestrconsts.liskmgotosourceeditor1 msgid "Go to source editor 1" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor10 msgid "Go to source editor 10" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor2 msgid "Go to source editor 2" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor3 msgid "Go to source editor 3" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor4 msgid "Go to source editor 4" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor5 msgid "Go to source editor 5" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor6 msgid "Go to source editor 6" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor7 msgid "Go to source editor 7" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor8 msgid "Go to source editor 8" msgstr "" #: lazarusidestrconsts.liskmgotosourceeditor9 msgid "Go to source editor 9" msgstr "" #: lazarusidestrconsts.liskminsertdateandtime msgid "Insert date and time" msgstr "Vložit datum a čas" #: lazarusidestrconsts.liskminsertifdef msgid "Insert $IFDEF" msgstr "Vložit $IFDEF" #: lazarusidestrconsts.liskminsertusername msgid "Insert username" msgstr "" #: lazarusidestrconsts.liskminspect msgid "Inspect" msgstr "Zkoumat" #: lazarusidestrconsts.liskmkeymappingscheme msgid "Keymapping Scheme" msgstr "Schéma mapování kláves" #: lazarusidestrconsts.liskmlazarusdefault msgid "Lazarus (default)" msgstr "Lazarus (výchozí)" #: lazarusidestrconsts.liskmmacosxapple msgid "Mac OS X (Apple style)" msgstr "Max OS X(styl Apple)" #: lazarusidestrconsts.liskmmacosxlaz msgid "Mac OS X (Lazarus style)" msgstr "Max OS X (styl Lazarus)" #: lazarusidestrconsts.liskmnewpackage msgid "New package" msgstr "Nový balíček" #: lazarusidestrconsts.liskmnewproject msgid "New project" msgstr "Nový projekt" #: lazarusidestrconsts.liskmnewprojectfromfile msgid "New project from file" msgstr "Nový projekt ze souboru" #: lazarusidestrconsts.liskmnewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts.liskmnoteallkeyswillbesettothevaluesofthechosenscheme msgid "Note: All keys will be set to the values of the chosen scheme." msgstr "" #: lazarusidestrconsts.liskmopenpackagefile msgid "Open package file" msgstr "Otevřít soubor balíčku" #: lazarusidestrconsts.liskmpackagegraph msgid "Package graph" msgstr "Graf balíčku" #: lazarusidestrconsts.liskmpastecomponentsfromclipboard msgid "Paste Components from clipboard" msgstr "Vložit komponenty ze schránky" #: lazarusidestrconsts.liskmpauseprogram msgid "Pause program" msgstr "Pozastavit program" #: lazarusidestrconsts.liskmpublishproject msgid "Publish project" msgstr "Zveřejnit projekt" #: lazarusidestrconsts.liskmquickcompilenolinking msgid "Quick compile, no linking" msgstr "Rychlý překlad, bez spojování" #: lazarusidestrconsts.liskmremoveactiveunitfromproject msgid "Remove active unit from project" msgstr "Odstranit aktivní jednotku z projektu" #: lazarusidestrconsts.liskmrunprogram msgid "Run program" msgstr "Spustit program" #: lazarusidestrconsts.liskmsaveall msgid "SaveAll" msgstr "UložitVše" #: lazarusidestrconsts.liskmsaveas msgid "SaveAs" msgstr "UložitJako" #: lazarusidestrconsts.liskmsaveproject msgid "Save project" msgstr "Uložit projekt" #: lazarusidestrconsts.liskmsaveprojectas msgid "Save project as" msgstr "Uložit projekt jako" #: lazarusidestrconsts.liskmselectlineend msgid "Select line end" msgstr "Vybrat ke konci řádku" #: lazarusidestrconsts.liskmselectlinestart msgid "Select line start" msgstr "Vybrat k začátku řádku" #: lazarusidestrconsts.liskmselectpagebottom msgid "Select page bottom" msgstr "Vybrat po konec stránky" #: lazarusidestrconsts.liskmselectpagetop msgid "Select page top" msgstr "Vybrat po začátek stránky" #: lazarusidestrconsts.liskmselectwordleft msgid "Select word left" msgstr "Vybrat slovo nalevo" #: lazarusidestrconsts.liskmselectwordright msgid "Select word right" msgstr "Vybrat slovo napravo" #: lazarusidestrconsts.liskmsetfreebookmark msgid "Set free Bookmark" msgstr "" #: lazarusidestrconsts.liskmsetmarker0 msgid "Set marker 0" msgstr "Nastavit značku 0" #: lazarusidestrconsts.liskmsetmarker1 msgid "Set marker 1" msgstr "Nastavit značku 1" #: lazarusidestrconsts.liskmsetmarker2 msgid "Set marker 2" msgstr "Nastavit značku 2" #: lazarusidestrconsts.liskmsetmarker3 msgid "Set marker 3" msgstr "Nastavit značku 3" #: lazarusidestrconsts.liskmsetmarker4 msgid "Set marker 4" msgstr "Nastavit značku 4" #: lazarusidestrconsts.liskmsetmarker5 msgid "Set marker 5" msgstr "Nastavit značku 5" #: lazarusidestrconsts.liskmsetmarker6 msgid "Set marker 6" msgstr "Nastavit značku 6" #: lazarusidestrconsts.liskmsetmarker7 msgid "Set marker 7" msgstr "Nastavit značku 7" #: lazarusidestrconsts.liskmsetmarker8 msgid "Set marker 8" msgstr "Nastavit značku 8" #: lazarusidestrconsts.liskmsetmarker9 msgid "Set marker 9" msgstr "Nastavit značku 9" #: lazarusidestrconsts.liskmstopprogram msgid "Stop program" msgstr "Zastavit program" #: lazarusidestrconsts.liskmtogglebetweenunitandform msgid "Toggle between Unit and Form" msgstr "" #: lazarusidestrconsts.liskmtogglemarker0 msgid "Toggle marker 0" msgstr "" #: lazarusidestrconsts.liskmtogglemarker1 msgid "Toggle marker 1" msgstr "" #: lazarusidestrconsts.liskmtogglemarker2 msgid "Toggle marker 2" msgstr "" #: lazarusidestrconsts.liskmtogglemarker3 msgid "Toggle marker 3" msgstr "" #: lazarusidestrconsts.liskmtogglemarker4 msgid "Toggle marker 4" msgstr "" #: lazarusidestrconsts.liskmtogglemarker5 msgid "Toggle marker 5" msgstr "" #: lazarusidestrconsts.liskmtogglemarker6 msgid "Toggle marker 6" msgstr "" #: lazarusidestrconsts.liskmtogglemarker7 msgid "Toggle marker 7" msgstr "" #: lazarusidestrconsts.liskmtogglemarker8 msgid "Toggle marker 8" msgstr "" #: lazarusidestrconsts.liskmtogglemarker9 msgid "Toggle marker 9" msgstr "" #: lazarusidestrconsts.liskmtoggleviewbreakpoints msgid "Toggle view Breakpoints" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcallstack msgid "Toggle view Call Stack" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcodeexplorer msgid "Toggle view Code Explorer" msgstr "" #: lazarusidestrconsts.liskmtoggleviewcomponentpalette msgid "Toggle view component palette" msgstr "Přepnout zobrazení palety komponent" #: lazarusidestrconsts.liskmtoggleviewdebuggeroutput msgid "Toggle view Debugger Output" msgstr "" #: lazarusidestrconsts.liskmtoggleviewdocumentationeditor msgid "Toggle view Documentation Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewidespeedbuttons msgid "Toggle view IDE speed buttons" msgstr "" #: lazarusidestrconsts.liskmtoggleviewlocalvariables msgid "Toggle view Local Variables" msgstr "" #: lazarusidestrconsts.liskmtoggleviewmessages msgid "Toggle view Messages" msgstr "" #: lazarusidestrconsts.liskmtoggleviewobjectinspector msgid "Toggle view Object Inspector" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsearchresults msgid "Toggle view Search Results" msgstr "" #: lazarusidestrconsts.liskmtoggleviewsourceeditor msgid "Toggle view Source Editor" msgstr "" #: lazarusidestrconsts.liskmtoggleviewwatches msgid "Toggle view Watches" msgstr "" #: lazarusidestrconsts.liskmviewjumphistory msgid "View jump history" msgstr "Zobrazit historii skoků" #: lazarusidestrconsts.liskmviewprojectoptions msgid "View project options" msgstr "Zobrazit nastavení projektu" #: lazarusidestrconsts.liskmviewprojectsource msgid "View project source" msgstr "Zobrazit zdroj projektu" #: lazarusidestrconsts.liskmviewunitinfo msgid "View Unit Info" msgstr "Zobrazit informace o jednotce" #: lazarusidestrconsts.lislaunchingapplicationinvalid msgid "Launching application invalid" msgstr "" #: lazarusidestrconsts.lislaunchingcmdline msgid "Launching target command line" msgstr "Spouštění cílové příkazové řádky" #: lazarusidestrconsts.lislazarusdesktopsettings msgid "Lazarus Desktop Settings" msgstr "Nastavení plochy Lazarusu" #: lazarusidestrconsts.lislazarusdirectory msgid "Lazarus directory" msgstr "Složka Lazarusu" #: lazarusidestrconsts.lislazarusdirectorynotfound msgid "Lazarus directory not found" msgstr "" #: lazarusidestrconsts.lislazaruseditorv msgid "Lazarus IDE v%s" msgstr "" #: lazarusidestrconsts.lislazarusfile msgid "Lazarus File" msgstr "Soubor Lazarusu" #: lazarusidestrconsts.lislazarusform msgid "Lazarus form" msgstr "Formulář Lazarusu" #: lazarusidestrconsts.lislazaruside msgid "Lazarus IDE" msgstr "Lazarus IDE" #: lazarusidestrconsts.lislazarusinclude msgid "Lazarus include file" msgstr "Zahrnutý soubor Lazarusu" #: lazarusidestrconsts.lislazaruslanguageid msgid "Lazarus language ID (e.g. en, de, br, fi)" msgstr "ID jazyka Lazarusu (např. en, de, br, cz)" #: lazarusidestrconsts.lislazaruslanguagename msgid "Lazarus language name (e.g. english, deutsch)" msgstr "Jméno jazyka Lazarusu (např. english, czech)" #: lazarusidestrconsts.lislazarusoptionsprojectfilename msgid "lazarus [options] " msgstr "lazarus [volby] " #: lazarusidestrconsts.lislazaruspackage msgid "Lazarus package" msgstr "Balíček Lazarusu" #: lazarusidestrconsts.lislazarusproject msgid "Lazarus project" msgstr "Projekt Lazarusu" #: lazarusidestrconsts.lislazarusprojectinfofile msgid "Lazarus Project Info file" msgstr "Informační soubor projektu Lazarusu" #: lazarusidestrconsts.lislazarusprojectsource msgid "Lazarus project source" msgstr "Zdrojový soubor Lazarusu" #: lazarusidestrconsts.lislazarusunit msgid "Lazarus unit" msgstr "Jednotka Lazarusu" #: lazarusidestrconsts.lislazarusversionstring msgid "%s beta" msgstr "%s beta" #: lazarusidestrconsts.lislazbuildaboaction msgid "Action" msgstr "Akce" #: lazarusidestrconsts.lislazbuildabochooseoutputdir msgid "Choose output directory of the IDE executable " msgstr "" #: lazarusidestrconsts.lislazbuildabopart msgid "Part" msgstr "Část" #: lazarusidestrconsts.lislazbuildadvancedbuildoptions msgid "Advanced Build Options" msgstr "Pokročilé volby sestavení" #: lazarusidestrconsts.lislazbuildbuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts.lislazbuildbuildcodetools msgid "Build CodeTools" msgstr "Sestavit kódové nástroje" #: lazarusidestrconsts.lislazbuildbuildcomponentssyneditcodetools msgid "Build components (SynEdit, CodeTools)" msgstr "Sestavit komponenty (SynEdit, CodeTools)" #: lazarusidestrconsts.lislazbuildbuildexamples msgid "Build examples" msgstr "Sestavit příklady" #: lazarusidestrconsts.lislazbuildbuildide msgid "Build IDE" msgstr "Sestavit IDE" #: lazarusidestrconsts.lislazbuildbuildjitform msgid "Build JITForm" msgstr "Sestavit JITForm" #: lazarusidestrconsts.lislazbuildbuildoptions msgid "Build Options" msgstr "Volby sestavení" #: lazarusidestrconsts.lislazbuildbuildsynedit msgid "Build SynEdit" msgstr "Sestavit SynEdit" #: lazarusidestrconsts.lislazbuildcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts.lislazbuildcleanall msgid "Clean all" msgstr "Vyčistit vše" #: lazarusidestrconsts.lislazbuildcleanbuild msgid "Clean+Build" msgstr "Vyčistit + Sestavit" #: lazarusidestrconsts.lislazbuildconfirmbuild msgid "Confirm before rebuilding Lazarus" msgstr "Potvrdit přes znovusestavením Lazarusu" #: lazarusidestrconsts.lislazbuilderrorwritingfile msgid "Error writing file" msgstr "Chyba zapisování souboru" #: lazarusidestrconsts.lislazbuildisnoninteractiveabortingnow msgid "%s%s%s%slazbuild is non interactive, aborting now." msgstr "" #: lazarusidestrconsts.lislazbuildlclinterface msgid "LCL interface" msgstr "Rozhranní LCL" #: lazarusidestrconsts.lislazbuildnone msgid "None" msgstr "Žádný" #: lazarusidestrconsts.lislazbuildok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts.lislazbuildoptions msgid "Options:" msgstr "Nastavení:" #: lazarusidestrconsts.lislazbuildqboapplcltarget msgid "Target" msgstr "Cíl" #: lazarusidestrconsts.lislazbuildqbobuildall msgid "Build All" msgstr "Sestavit vše" #: lazarusidestrconsts.lislazbuildqbobuildidewithoutpackages msgid "Build IDE without Packages" msgstr "Sestavit IDE bez balíčků" #: lazarusidestrconsts.lislazbuildqbobuildidewpackages msgid "Build IDE with Packages" msgstr "Sestavit IDE s balíčky" #: lazarusidestrconsts.lislazbuildqbobuildlcl msgid "Build LCL" msgstr "Sestavit LCL" #: lazarusidestrconsts.lislazbuildqbobuildother msgid "Other" msgstr "Jiné" #: lazarusidestrconsts.lislazbuildqbocleanupbuildall msgid "Clean Up + Build all" msgstr "Vyčistit + Sestavit vše" #: lazarusidestrconsts.lislazbuildquickbuildoptions msgid "Quick Build Options" msgstr "Volby rychlého sestavení" #: lazarusidestrconsts.lislazbuildrestartafterbuild msgid "Restart after successful Build" msgstr "Restartovat po úspěšném sestavení" #: lazarusidestrconsts.lislazbuildsavesettings msgid "Save settings" msgstr "Uložit nastavení" #: lazarusidestrconsts.lislazbuildtargetcpu msgid "Target CPU:" msgstr "Cílové CPU" #: lazarusidestrconsts.lislazbuildtargetdirectory msgid "Target directory:" msgstr "Cílový adresář:" #: lazarusidestrconsts.lislazbuildtargetos msgid "Target OS:" msgstr "Cílový OS:" #: lazarusidestrconsts.lislazbuildunabletowritefile msgid "Unable to write file \"%s\":%s" msgstr "Nelze zapisovat do souboru \"%s\":%s" #: lazarusidestrconsts.lislazbuildwithstaticpackages msgid "With packages" msgstr "S balíčky" #: lazarusidestrconsts.lislcl msgid "LCL" msgstr "LCL" #: lazarusidestrconsts.lislclunitpathmissing msgid "LCL unit path missing" msgstr "" #: lazarusidestrconsts.lislclwidgettype msgid "LCL Widget Type" msgstr "" #: lazarusidestrconsts.lisldaddlinktoinherited msgid "Add link to inherited" msgstr "Přidat odkaz ke zděděnému" #: lazarusidestrconsts.lisldcopyfrominherited msgid "Copy from inherited" msgstr "Kopírovat ze zděděného" #: lazarusidestrconsts.lislddoesnothaveanyvalidlazdocpathunabletocreatethefpdo msgid "%s does not have any valid LazDoc path.%sUnable to create the fpdoc file for %s" msgstr "%s nemá žádnou platnou LazDoc cestu.%sNelze vytvořit soubor fpdoc pro %s" #: lazarusidestrconsts.lisldmoveentriestoinherited msgid "Move entries to inherited" msgstr "Přesunout položky do zděděného" #: lazarusidestrconsts.lisldnovalidlazdocpath msgid "No valid LazDoc path" msgstr "" #: lazarusidestrconsts.lisldtheunitisnotownedbeanypackageorprojectpleaseaddthe msgid "The unit %s is not owned be any package or project.%sPlease add the unit to a package or project.%sUnable to create the fpdoc file." msgstr "" #: lazarusidestrconsts.lisleaveemptyfo msgid "Leave empty for default .po file" msgstr "Nechejte prázdné pro výchozí soubor .po" #: lazarusidestrconsts.lisleft msgid "Left" msgstr "Levý" #: lazarusidestrconsts.lisleftborderspacespinedithint msgid "Left borderspace. This value is added to base borderspace and used for the space left to the control." msgstr "" #: lazarusidestrconsts.lisleftgroupboxcaption msgid "Left anchoring" msgstr "" #: lazarusidestrconsts.lisleftsiblingcomboboxhint msgid "This is the sibling control to which the left side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisleftsides msgid "Left sides" msgstr "" #: lazarusidestrconsts.lisleftspaceequally msgid "Left space equally" msgstr "" #: lazarusidestrconsts.lislegaltrademarks msgid "Legal Trademarks:" msgstr "" #: lazarusidestrconsts.lislevels msgid "Levels" msgstr "Úrovně" #: lazarusidestrconsts.lislfmfile msgid "LFM file" msgstr "" #: lazarusidestrconsts.lislfmfilecorrupt msgid "LFM file corrupt" msgstr "Poškozený soubor LFM" #: lazarusidestrconsts.lislfmfilenotfound msgid "LFM file not found" msgstr "Soubor LFM nenalezen" #: lazarusidestrconsts.lislgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lislibraryafreepascallibrarydllunderwindowssounderlin msgid "Library%sA freepascal library (.dll under windows, .so under linux, .dylib under macosx). The library source file is automatically maintained by Lazarus." msgstr "" #: lazarusidestrconsts.lislibrarypath msgid "library path" msgstr "cesta knihovny" #: lazarusidestrconsts.lislinelength msgid "Line/Length" msgstr "Řádek/Délka" #: lazarusidestrconsts.lislink msgid "Link:" msgstr "Odkaz:" #: lazarusidestrconsts.lislinkeroptions msgid "linker options" msgstr "" #: lazarusidestrconsts.lislinktarget msgid "Link target" msgstr "" #: lazarusidestrconsts.lisloadingfailed msgid "Loading %s failed." msgstr "" #: lazarusidestrconsts.lislocals msgid "Locals" msgstr "Místní" #: lazarusidestrconsts.lislocalsdlgname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts.lislocalsdlgvalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts.lislogo msgid "Logo" msgstr "Logo" #: lazarusidestrconsts.lismacpascal msgid "Mac Pascal" msgstr "Mac Pascal" #: lazarusidestrconsts.lismacropromptenterdata msgid "Enter data" msgstr "Zadejte údaje" #: lazarusidestrconsts.lismacropromptenterrunparameters msgid "Enter run parameters" msgstr "Zadejte spouštěcí parametry" #: lazarusidestrconsts.lismainunithasapplicationcreateformstatements msgid "Main Unit has Application.CreateForm statements" msgstr "" #: lazarusidestrconsts.lismainunithasapplicationtitlestatements msgid "Main Unit has Application.Title statements" msgstr "" #: lazarusidestrconsts.lismainunithasusessectioncontainingallunitsofproject msgid "Main Unit has Uses Section containing all Units of project" msgstr "" #: lazarusidestrconsts.lismainunitispascalsource msgid "Main Unit is Pascal Source" msgstr "" #: lazarusidestrconsts.lismakeexe msgid "Make Executable" msgstr "Vytvořit spustitelný" #: lazarusidestrconsts.lismakenotfound msgid "Make not found" msgstr "Nenalezen Make" #: lazarusidestrconsts.lismakeresourcestring msgid "Make ResourceString" msgstr "" #: lazarusidestrconsts.lismakeresstrappendtosection msgid "Append to section" msgstr "Doplnit k sekci" #: lazarusidestrconsts.lismakeresstrchooseanothername msgid "The resourcestring %s%s%s already exists.%sPlease choose another name.%sUse Ignore to add it anyway." msgstr "" #: lazarusidestrconsts.lismakeresstrconversionoptions msgid "Conversion Options" msgstr "" #: lazarusidestrconsts.lismakeresstrcustomidentifier msgid "Custom identifier" msgstr "" #: lazarusidestrconsts.lismakeresstrdialogidentifier msgid "Identifier" msgstr "Identifikátor" #: lazarusidestrconsts.lismakeresstridentifierlength msgid "Identifier length:" msgstr "" #: lazarusidestrconsts.lismakeresstridentifierprefix msgid "Identifier prefix:" msgstr "" #: lazarusidestrconsts.lismakeresstrinsertalphabetically msgid "Insert alphabetically" msgstr "" #: lazarusidestrconsts.lismakeresstrinsertcontexttsensitive msgid "Insert context sensitive" msgstr "" #: lazarusidestrconsts.lismakeresstrinvalidresourcestringsect msgid "Invalid Resourcestring section" msgstr "" #: lazarusidestrconsts.lismakeresstrpleasechoosearesourcestring msgid "Please choose a resourcestring section from the list." msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringalreadyexis msgid "Resourcestring already exists" msgstr "" #: lazarusidestrconsts.lismakeresstrresourcestringsection msgid "Resourcestring section:" msgstr "" #: lazarusidestrconsts.lismakeresstrsourcepreview msgid "Source preview" msgstr "" #: lazarusidestrconsts.lismakeresstrstringconstantinsource msgid "String constant in source" msgstr "Konstantní řetězec ve zdroji" #: lazarusidestrconsts.lismakeresstrstringswithsamevalue msgid "Strings with same value:" msgstr "Řetězec se stejnou hodnotou:" #: lazarusidestrconsts.lismaxs msgid "Max %d" msgstr "Max %d" #: lazarusidestrconsts.lismemorydump msgid "Memory Dump" msgstr "Výpis paměti" #: lazarusidestrconsts.lismendebuggeroptions msgid "Debugger Options ..." msgstr "Nastavení ladícího nástroje..." #: lazarusidestrconsts.lismenuabortbuild msgid "Abort Build" msgstr "Přerušit sestavení" #: lazarusidestrconsts.lismenuaddbpsource msgid "Source breakpoint" msgstr "Zdrojový bod přerušení" #: lazarusidestrconsts.lismenuaddbreakpoint msgid "Add breakpoint" msgstr "Přidat bod přerušení" #: lazarusidestrconsts.lismenuaddcurunittopkg msgid "Add active unit to a package" msgstr "Přidat aktivní jednotku do balíčku" #: lazarusidestrconsts.lismenuaddjumppointtohistory msgid "Add jump point to history" msgstr "Přidat bod skoku do historie" #: lazarusidestrconsts.lismenuaddtoproject msgid "Add editor file to Project" msgstr "Přidat editovaný soubor do projektu" #: lazarusidestrconsts.lismenuaddwatch msgid "Add watch ..." msgstr "Přidat sledování ..." #: lazarusidestrconsts.lismenubeaklinesinselection msgid "Break Lines in selection" msgstr "Ukončit žádky ve výběru" #: lazarusidestrconsts.lismenubuild msgid "Build" msgstr "Sestavit" #: lazarusidestrconsts.lismenubuildall msgid "Build all" msgstr "Sestavit vše" #: lazarusidestrconsts.lismenubuildfile msgid "Build File" msgstr "Sestavit soubor" #: lazarusidestrconsts.lismenubuildlazarus msgid "Build Lazarus" msgstr "Sestavit Lazarus" #: lazarusidestrconsts.lismenuchecklfm msgid "Check LFM file in editor" msgstr "Zkontrolovat soubor LFM v editoru" #: lazarusidestrconsts.lismenucleandirectory msgid "Clean directory ..." msgstr "Vyčistit adresář..." #: lazarusidestrconsts.lismenuclose msgid "Close" msgstr "Zavřít" #: lazarusidestrconsts.lismenucloseall msgid "Close a&ll editor files" msgstr "" #: lazarusidestrconsts.lismenucloseproject msgid "Close Project" msgstr "Zavřít projekt" #: lazarusidestrconsts.lismenucodetoolsdefineseditor msgid "CodeTools defines editor ..." msgstr "Editor definic pro CodeTools..." #: lazarusidestrconsts.lismenucodetoolsoptions msgid "CodeTools Options ..." msgstr "Nastavení CodeTools..." #: lazarusidestrconsts.lismenucollectpofil msgid "Collect .po files" msgstr "Sbírat soubory .po" #: lazarusidestrconsts.lismenucommentselection msgid "Comment selection" msgstr "Zakomentovat výběr" #: lazarusidestrconsts.lismenucompileroptions msgid "Compiler Options ..." msgstr "Volby překladače ..." #: lazarusidestrconsts.lismenucompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts.lismenuconditionalselection msgid "Insert $IFDEF..." msgstr "Vložit IFDEF..." #: lazarusidestrconsts.lismenuconfigbuildfile msgid "Configure Build+Run File ..." msgstr "Nastavit soubor pro Sestavitení+Spuštění..." #: lazarusidestrconsts.lismenuconfigcustomcomps msgid "Configure custom components ..." msgstr "Konfigurovat vlastní komponenty..." #: lazarusidestrconsts.lismenuconfigexternaltools msgid "Configure external tools ..." msgstr "" #: lazarusidestrconsts.lismenuconfigurebuildlazarus msgid "Configure \"Build Lazarus\" ..." msgstr "Nastavení \"Sestavení Lazarusu\" ..." #: lazarusidestrconsts.lismenuconfigurehelp msgid "Configure Help ..." msgstr "Nastavit nápovědu..." #: lazarusidestrconsts.lismenucontexthelp msgid "Context sensitive Help" msgstr "Kontextová nápověda" #: lazarusidestrconsts.lismenuconvertdelphipackage msgid "Convert Delphi package to Lazarus package ..." msgstr "Převést Delphi balíček na Lazarus balíček ..." #: lazarusidestrconsts.lismenuconvertdelphiproject msgid "Convert Delphi project to Lazarus project ..." msgstr "Převést Delphi projekt na Lazarus projekt ..." #: lazarusidestrconsts.lismenuconvertdelphiunit msgid "Convert Delphi unit to Lazarus unit ..." msgstr "Převést Delphi jednotku na Lazarus jednotku ..." #: lazarusidestrconsts.lismenuconvertdfmtolfm msgid "Convert DFM file to LFM ..." msgstr "Převést DFM soubor na LFM ..." #: lazarusidestrconsts.lismenuconvertencoding msgid "Convert encoding of projects/packages ..." msgstr "" #: lazarusidestrconsts.lismenucopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts.lismenucreatefpdocfiles msgid "Create FPDoc files" msgstr "Vytvořit soubory FPDoc" #: lazarusidestrconsts.lismenucreatepofile msgid "Create .po files" msgstr "Vytvořit soubory .po" #: lazarusidestrconsts.lismenucut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts.lismenudebugwindows msgid "Debug windows" msgstr "Ladící okna" #: lazarusidestrconsts.lismenudiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts.lismenuedit msgid "&Edit" msgstr "&Editace" #: lazarusidestrconsts.lismenueditcodetemplates msgid "Code Templates ..." msgstr "Šablony kódu..." #: lazarusidestrconsts.lismenueditcontexthelp msgid "Edit context sensitive Help" msgstr "Upravit kontextově citlivou nápovědu" #: lazarusidestrconsts.lismenueditinstallpkgs msgid "Configure installed packages ..." msgstr "Konfigurovat instalované balíčky..." #: lazarusidestrconsts.lismenueditorcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts.lismenueditorcreatesubmenu msgid "Create Submenu" msgstr "" #: lazarusidestrconsts.lismenueditordeletefromtemplate msgid "Delete From Template..." msgstr "Odstranit ze šablony..." #: lazarusidestrconsts.lismenueditordeleteitem msgid "Delete Item" msgstr "Odstranit položku" #: lazarusidestrconsts.lismenueditorhandleonclickevent msgid "Handle OnClick Event" msgstr "" #: lazarusidestrconsts.lismenueditorinsertfromtemplate msgid "Insert From Template..." msgstr "" #: lazarusidestrconsts.lismenueditorinsertnewitemafter msgid "Insert New Item (after)" msgstr "" #: lazarusidestrconsts.lismenueditorinsertnewitembefore msgid "Insert New Item (before)" msgstr "" #: lazarusidestrconsts.lismenueditormenueditor msgid "Menu Editor" msgstr "Editor menu" #: lazarusidestrconsts.lismenueditormovedown msgid "Move Down (or right)" msgstr "" #: lazarusidestrconsts.lismenueditormoveup msgid "Move Up (or left)" msgstr "" #: lazarusidestrconsts.lismenueditornewtemplatedescription msgid "New Template Description..." msgstr "Nový popis šablony..." #: lazarusidestrconsts.lismenueditoroptions msgid "Editor options ..." msgstr "Nastavení editoru ..." #: lazarusidestrconsts.lismenueditorsaveastemplate msgid "Save As Template..." msgstr "Uložit jako šablonu..." #: lazarusidestrconsts.lismenueditorselectmenu msgid "Select Menu:" msgstr "Vyberte menu:" #: lazarusidestrconsts.lismenueditorselecttemplate msgid "Select Template:" msgstr "Vyberte šablonu:" #: lazarusidestrconsts.lismenueditortemplatepreview msgid "Template Preview" msgstr "Náhled šablony" #: lazarusidestrconsts.lismenuencloseselection msgid "Enclose selection ..." msgstr "Obklopit výběr" #: lazarusidestrconsts.lismenuenvironent msgid "E&nvironment" msgstr "P&rostředí" #: lazarusidestrconsts.lismenuevaluate msgid "Evaluate/Modify ..." msgstr "Vyhodnocení/Upravení..." #: lazarusidestrconsts.lismenuextractproc msgid "Extract procedure ..." msgstr "Vyjmout proceduru..." #: lazarusidestrconsts.lismenufile msgid "&File" msgstr "&Soubor" #: lazarusidestrconsts.lismenufind msgid "Find" msgstr "Najít" #: lazarusidestrconsts.lismenufind2 msgid "&Find ..." msgstr "&Hledat..." #: lazarusidestrconsts.lismenufindblockotherendofcodeblock msgid "Find other end of code block" msgstr "Najít jiný konec bloku kódu" #: lazarusidestrconsts.lismenufindcodeblockstart msgid "Find code block start" msgstr "Najít začátek bloku kód" #: lazarusidestrconsts.lismenufinddeclarationatcursor msgid "Find Declaration at cursor" msgstr "Najít deklaraci na pozici kurzoru" #: lazarusidestrconsts.lismenufindidentifierrefs msgid "Find Identifier References ..." msgstr "Najít odkazy na identifikátor" #: lazarusidestrconsts.lismenufindinfiles msgid "Find &in files ..." msgstr "Najít &v souborech..." #: lazarusidestrconsts.lismenufindnext msgid "Find &Next" msgstr "Najít &Další" #: lazarusidestrconsts.lismenufindprevious msgid "Find &Previous" msgstr "Najít &Předchozí" #: lazarusidestrconsts.lismenufpdoceditor msgid "FPDoc Editor" msgstr "Editor FPDoc" #: lazarusidestrconsts.lismenugeneraloptions msgid "Options ..." msgstr "Nastavení..." #: lazarusidestrconsts.lismenugotoincludedirective msgid "Goto include directive" msgstr "Jít na směrnici pro zahrnutí souboru" #: lazarusidestrconsts.lismenugotoline msgid "Goto line ..." msgstr "Přejít na řádek..." #: lazarusidestrconsts.lismenuguessmisplacedifdef msgid "Guess misplaced IFDEF/ENDIF" msgstr "Odhadnout chybně umístěný IFDEF/ENDIF" #: lazarusidestrconsts.lismenuguessunclosedblock msgid "Guess unclosed block" msgstr "Odhadnout neuzavřený blok" #: lazarusidestrconsts.lismenuhelp msgid "&Help" msgstr "&Nápověda" #: lazarusidestrconsts.lismenuideinternals msgid "IDE internals" msgstr "Vnitřek IDE" #: lazarusidestrconsts.lismenuincrementalfind msgid "Incremental Find" msgstr "Přírůstkové hledání" #: lazarusidestrconsts.lismenuindentselection msgid "Indent selection" msgstr "Odsadit výběr" #: lazarusidestrconsts.lismenuinsertchangelogentry msgid "ChangeLog entry" msgstr "Položka Poznámek k vydání" #: lazarusidestrconsts.lismenuinsertcharacter msgid "Insert from Character Map" msgstr "Vložit z mapy znaků" #: lazarusidestrconsts.lismenuinsertcvskeyword msgid "CVS keyword" msgstr "Klíčové slovo CVS" #: lazarusidestrconsts.lismenuinsertdatetime msgid "Current date and time" msgstr "Aktuální datum a čas" #: lazarusidestrconsts.lismenuinsertgeneral msgid "General" msgstr "Obecné" #: lazarusidestrconsts.lismenuinsertgplnotice msgid "GPL notice" msgstr "Poznámka GPL" #: lazarusidestrconsts.lismenuinsertlgplnotice msgid "LGPL notice" msgstr "Poznámka LGPL" #: lazarusidestrconsts.lismenuinsertmodifiedlgplnotice msgid "Modified LGPL notice" msgstr "Poznámka k upravené LGPL" #: lazarusidestrconsts.lismenuinserttext msgid "Insert text" msgstr "Vložit text" #: lazarusidestrconsts.lismenuinsertusername msgid "Current username" msgstr "Aktuální uživatelské jméno" #: lazarusidestrconsts.lismenuinspect msgid "Inspect ..." msgstr "Zkoumat..." #: lazarusidestrconsts.lismenujumpback msgid "Jump back" msgstr "Skočit zpět" #: lazarusidestrconsts.lismenujumpforward msgid "Jump forward" msgstr "Skočit vpřed" #: lazarusidestrconsts.lismenujumpto msgid "Jump to" msgstr "Skočit na" #: lazarusidestrconsts.lismenujumptonextbookmark msgid "Jump to next bookmark" msgstr "Skočit na další značku" #: lazarusidestrconsts.lismenujumptonexterror msgid "Jump to next error" msgstr "Skočit na následující chybu" #: lazarusidestrconsts.lismenujumptoprevbookmark msgid "Jump to previous bookmark" msgstr "Skočit na předchozí značku" #: lazarusidestrconsts.lismenujumptopreverror msgid "Jump to previous error" msgstr "Skočit na předchozí chybu" #: lazarusidestrconsts.lismenulowercaseselection msgid "Lowercase selection" msgstr "Změnit výběr na malá písmena" #: lazarusidestrconsts.lismenumakeresourcestring msgid "Make Resource String ..." msgstr "Vytvořit zdrojový řetězec..." #: lazarusidestrconsts.lismenunewform msgid "New Form" msgstr "Nový formulář" #: lazarusidestrconsts.lismenunewother msgid "New ..." msgstr "Nový..." #: lazarusidestrconsts.lismenunewpackage msgid "New package ..." msgstr "Nový balíček..." #: lazarusidestrconsts.lismenunewproject msgid "New Project ..." msgstr "Nový projekt..." #: lazarusidestrconsts.lismenunewprojectfromfile msgid "New Project from file ..." msgstr "Nový projekt ze souboru..." #: lazarusidestrconsts.lismenunewunit msgid "New Unit" msgstr "Nová jednotka" #: lazarusidestrconsts.lismenuonlinehelp msgid "Online Help" msgstr "Online nápověda" #: lazarusidestrconsts.lismenuopen msgid "&Open ..." msgstr "" #: lazarusidestrconsts.lismenuopenfilenameatcursor msgid "Open filename at cursor" msgstr "Otevřít jméno souboru na pozici kurzoru" #: lazarusidestrconsts.lismenuopenpackage msgid "Open loaded package ..." msgstr "Otevřít načtený balíček..." #: lazarusidestrconsts.lismenuopenpackagefile msgid "Open package file (.lpk) ..." msgstr "Otevřít soubor balíčku (.lpk)..." #: lazarusidestrconsts.lismenuopenpackageofcurunit msgid "Open package of current unit" msgstr "Otevřít balíček aktuální jednotky" #: lazarusidestrconsts.lismenuopenproject msgid "Open Project ..." msgstr "Otevřít projekt..." #: lazarusidestrconsts.lismenuopenrecent msgid "Open &Recent ..." msgstr "" #: lazarusidestrconsts.lismenuopenrecentpkg msgid "Open recent package ..." msgstr "Otevřít nedávný balíček..." #: lazarusidestrconsts.lismenuopenrecentproject msgid "Open Recent Project ..." msgstr "Otevřít nedávný projekt..." #: lazarusidestrconsts.lismenupackage msgid "&Package" msgstr "&Balíček" #: lazarusidestrconsts.lismenupackagegraph msgid "Package Graph ..." msgstr "Graf balíčku..." #: lazarusidestrconsts.lismenupackagelinks msgid "Package links ..." msgstr "Odkazy balíčku..." #: lazarusidestrconsts.lismenupaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts.lismenupause msgid "Pause" msgstr "Pozastavit" #: lazarusidestrconsts.lismenuproject msgid "&Project" msgstr "&Projekt" #: lazarusidestrconsts.lismenuprojectinspector msgid "Project Inspector" msgstr "Inspektor projektu" #: lazarusidestrconsts.lismenuprojectoptions msgid "Project Options ..." msgstr "Volby projektu ..." #: lazarusidestrconsts.lismenuprojectrun msgid "Run" msgstr "Spustit" #: lazarusidestrconsts.lismenupublishproject msgid "Publish Project ..." msgstr "Vydat projekt..." #: lazarusidestrconsts.lismenuquickcompile msgid "Quick compile" msgstr "Rychlý překlad" #: lazarusidestrconsts.lismenuquicksyntaxcheck msgid "Quick syntax check" msgstr "Rychlá kontrola syntaxe" #: lazarusidestrconsts.lismenuquicksyntaxcheckok msgid "Quick syntax check OK" msgstr "" #: lazarusidestrconsts.lismenuquit msgid "&Quit" msgstr "" #: lazarusidestrconsts.lismenuredo msgid "Redo" msgstr "Opakovat změnu" #: lazarusidestrconsts.lismenuremovefromproject msgid "Remove from Project ..." msgstr "Odebrat z projektu..." #: lazarusidestrconsts.lismenurenameidentifier msgid "Rename Identifier ..." msgstr "Přejmenovat identifikátor" #: lazarusidestrconsts.lismenureplace msgid "Replace" msgstr "Nahradit" #: lazarusidestrconsts.lismenureplace2 msgid "&Replace ..." msgstr "&Nahradit..." #: lazarusidestrconsts.lismenureportingbug msgid "Reporting a bug..." msgstr "Nahlásit závadu..." #: lazarusidestrconsts.lismenurescanfpcsourcedirectory msgid "Rescan FPC source directory" msgstr "Znovu projít zdrojový adresář FPC" #: lazarusidestrconsts.lismenuresetdebugger msgid "Reset debugger" msgstr "Resetovat ladící nástroj" #: lazarusidestrconsts.lismenurestart msgid "Restart" msgstr "Restartovat" #: lazarusidestrconsts.lismenurevert msgid "Revert" msgstr "Navrátit" #: lazarusidestrconsts.lismenurun msgid "&Run" msgstr "&Spustit" #: lazarusidestrconsts.lismenurunfile msgid "Run File" msgstr "Spustit soubor" #: lazarusidestrconsts.lismenurunparameters msgid "Run Parameters ..." msgstr "Spustit s parametry..." #: lazarusidestrconsts.lismenuruntocursor msgid "Run to cursor" msgstr "Spustit po ukazatel" #: lazarusidestrconsts.lismenusave msgid "&Save" msgstr "" #: lazarusidestrconsts.lismenusaveall msgid "Save All" msgstr "Uložit vše" #: lazarusidestrconsts.lismenusaveas msgid "Save &As ..." msgstr "" #: lazarusidestrconsts.lismenusaveproject msgid "Save Project" msgstr "Uložit projekt" #: lazarusidestrconsts.lismenusaveprojectas msgid "Save Project As ..." msgstr "Uložit projekt jako..." #: lazarusidestrconsts.lismenusearch msgid "&Search" msgstr "&Hledat" #: lazarusidestrconsts.lismenuselect msgid "Select" msgstr "Vybrat" #: lazarusidestrconsts.lismenuselectall msgid "Select all" msgstr "Vybrat vše" #: lazarusidestrconsts.lismenuselectcodeblock msgid "Select code block" msgstr "Vybrat blok kódu" #: lazarusidestrconsts.lismenuselectline msgid "Select line" msgstr "Vybrat řádek" #: lazarusidestrconsts.lismenuselectparagraph msgid "Select paragraph" msgstr "Vybrat odstavec" #: lazarusidestrconsts.lismenuselecttobrace msgid "Select to brace" msgstr "Vybrat po závorku" #: lazarusidestrconsts.lismenuselectword msgid "Select word" msgstr "Vybrat slovo" #: lazarusidestrconsts.lismenusetfreebookmark msgid "Set a free bookmark" msgstr "Nastavit volnou záložku" #: lazarusidestrconsts.lismenusortselection msgid "Sort selection ..." msgstr "Seřadit výběr" #: lazarusidestrconsts.lismenustepinto msgid "Step into" msgstr "Vejít do" #: lazarusidestrconsts.lismenustepover msgid "Step over" msgstr "Přejít přes" #: lazarusidestrconsts.lismenustop msgid "Stop" msgstr "Zastavit" #: lazarusidestrconsts.lismenutabstospacesselection msgid "Tabs to spaces in selection" msgstr "" #: lazarusidestrconsts.lismenutemplateabout msgid "About" msgstr "O aplikaci" #: lazarusidestrconsts.lismenutemplateclose msgid "Close" msgstr "Zavřít" #: lazarusidestrconsts.lismenutemplatecontents msgid "Contents" msgstr "Obsah" #: lazarusidestrconsts.lismenutemplatecopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts.lismenutemplatecut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts.lismenutemplatedescriptionstandardeditmenu msgid "Standard Edit Menu" msgstr "Normální menu Editace" #: lazarusidestrconsts.lismenutemplatedescriptionstandardfilemenu msgid "Standard File Menu" msgstr "Normální menu Soubor" #: lazarusidestrconsts.lismenutemplatedescriptionstandardhelpmenu msgid "Standard Help Menu" msgstr "Normální menu Nápověda" #: lazarusidestrconsts.lismenutemplateedit msgid "Edit" msgstr "Úpravy" #: lazarusidestrconsts.lismenutemplateexit msgid "Exit" msgstr "Ukončit" #: lazarusidestrconsts.lismenutemplatefile msgid "File" msgstr "Soubor" #: lazarusidestrconsts.lismenutemplatefind msgid "Find" msgstr "Najít" #: lazarusidestrconsts.lismenutemplatefindnext msgid "Find Next" msgstr "Najít další" #: lazarusidestrconsts.lismenutemplatehelp msgid "Help" msgstr "Nápověda" #: lazarusidestrconsts.lismenutemplatenew msgid "New" msgstr "Nový" #: lazarusidestrconsts.lismenutemplateopen msgid "Open" msgstr "Otevřít" #: lazarusidestrconsts.lismenutemplateopenrecent msgid "Open Recent" msgstr "Otevřít nedávný" #: lazarusidestrconsts.lismenutemplatepaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts.lismenutemplateredo msgid "Redo" msgstr "Provést znovu" #: lazarusidestrconsts.lismenutemplatesave msgid "Save" msgstr "Uložit" #: lazarusidestrconsts.lismenutemplatesaveas msgid "Save As" msgstr "Uložit jako" #: lazarusidestrconsts.lismenutemplatetutorial msgid "Tutorial" msgstr "Cvičení" #: lazarusidestrconsts.lismenutemplateundo msgid "Undo" msgstr "Vrátit zpět" #: lazarusidestrconsts.lismenutogglecomment msgid "Toggle comment" msgstr "" #: lazarusidestrconsts.lismenutools msgid "&Tools" msgstr "&Nástroje" #: lazarusidestrconsts.lismenuuncommentselection msgid "Uncomment selection" msgstr "Odkomentovat výběr" #: lazarusidestrconsts.lismenuundo msgid "Undo" msgstr "Vrátit změnu" #: lazarusidestrconsts.lismenuunindentselection msgid "Unindent selection" msgstr "Vrátit odsazení výběru" #: lazarusidestrconsts.lismenuuppercaseselection msgid "Uppercase selection" msgstr "Změnit výběr na velká písmena" #: lazarusidestrconsts.lismenuview msgid "&View" msgstr "&Zobrazení" #: lazarusidestrconsts.lismenuviewanchoreditor msgid "Anchor Editor" msgstr "" #: lazarusidestrconsts.lismenuviewassembler msgid "Assembler" msgstr "" #: lazarusidestrconsts.lismenuviewbreakpoints msgid "BreakPoints" msgstr "Body přerušení" #: lazarusidestrconsts.lismenuviewcallstack msgid "Call Stack" msgstr "Zásobník volání" #: lazarusidestrconsts.lismenuviewcodebrowser msgid "Code Browser" msgstr "Prohlížeč kódu" #: lazarusidestrconsts.lismenuviewcodeexplorer msgid "Code Explorer" msgstr "Prohlížeč kódu" #: lazarusidestrconsts.lismenuviewcomponentpalette msgid "Component Palette" msgstr "" #: lazarusidestrconsts.lismenuviewcomponents msgid "&Components" msgstr "&Komponenty" #: lazarusidestrconsts.lismenuviewdebugoutput msgid "Debug output" msgstr "Ladící výstup" #: lazarusidestrconsts.lismenuviewforms msgid "Forms..." msgstr "Formuláře..." #: lazarusidestrconsts.lismenuviewidespeedbuttons msgid "IDE speed buttons" msgstr "" #: lazarusidestrconsts.lismenuviewjumphistory msgid "Jump-History ..." msgstr "" #: lazarusidestrconsts.lismenuviewlocalvariables msgid "Local Variables" msgstr "Místní proměnné" #: lazarusidestrconsts.lismenuviewmessages msgid "Messages" msgstr "Zprávy" #: lazarusidestrconsts.lismenuviewobjectinspector msgid "Object Inspector" msgstr "Inspektor objektů" #: lazarusidestrconsts.lismenuviewregisters msgid "Registers" msgstr "Registrace" #: lazarusidestrconsts.lismenuviewrestrictionbrowser msgid "Restriction Browser" msgstr "Prohlížeč omezení" #: lazarusidestrconsts.lismenuviewsearchresults msgid "Search Results" msgstr "Výsledky hledání" #: lazarusidestrconsts.lismenuviewsource msgid "&View Source" msgstr "&Zobrazení zdroje" #: lazarusidestrconsts.lismenuviewsourceeditor msgid "Source Editor" msgstr "Editor zdrojového kódu" #: lazarusidestrconsts.lismenuviewtodolist msgid "ToDo List" msgstr "Seznam úkolů" #: lazarusidestrconsts.lismenuviewtoggleformunit msgid "Toggle form/unit view" msgstr "Změnit zobrazení forumář/jednotka" #: lazarusidestrconsts.lismenuviewunitdependencies msgid "Unit Dependencies" msgstr "" #: lazarusidestrconsts.lismenuviewunitinfo msgid "Unit Information" msgstr "" #: lazarusidestrconsts.lismenuviewunits msgid "Units..." msgstr "Jednotky..." #: lazarusidestrconsts.lismenuviewwatches msgid "Watches" msgstr "Sledování" #: lazarusidestrconsts.lismenuwindow msgid "&Window" msgstr "&Okno" #: lazarusidestrconsts.lismessageseditor msgid "Messages Editor" msgstr "Editor zpráv" #: lazarusidestrconsts.lismethodclassnotfound msgid "Method class not found" msgstr "Třída metody nenalezena" #: lazarusidestrconsts.lismissingevents msgid "Missing Events" msgstr "Chybějící události" #: lazarusidestrconsts.lismissingidentifiers msgid "Missing identifiers" msgstr "Chybějící identifikátory" #: lazarusidestrconsts.lismissingpackages msgid "Missing Packages" msgstr "Chybějící balíčky" #: lazarusidestrconsts.lismodifiedlgplnotice msgid "%sCopyright (C) %sThis library is free software; you can redistribute it and/or modify it under the terms of the GNU Library General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version with the following modification:%sAs a special exception, the copyright holders of this library give you permission to link this library with independent modules to produce an executable, regardless of the license terms of these independent modules,and to copy and distribute the resulting executable under terms of your choice, provided that you also meet, for each linked independent module, the terms and conditions of the license of that module. An independent module is a module which is not derived from or based on this library. If you modify this library, you may extend this exception to your version of the library, but you are not obligated to do so. If you do not wish to do so, delete this exception statement from your version.%sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Library General Public License for more details. %sYou should have received a copy of the GNU Library General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA." msgstr "" #: lazarusidestrconsts.lismore msgid "More" msgstr "Více" #: lazarusidestrconsts.lismovepage msgid "Move Page ..." msgstr "Přesunout stránku..." #: lazarusidestrconsts.lismvdocking msgid "Docking" msgstr "Dokování" #: lazarusidestrconsts.lismvsavemessagestofiletxt msgid "Save messages to file (*.txt)" msgstr "Uložit zprávy do souboru (*.txt)" #: lazarusidestrconsts.lisnameconflict msgid "Name conflict" msgstr "Konflikt jmen" #: lazarusidestrconsts.lisnameofnewprocedure msgid "Name of new procedure" msgstr "Jméno nové procedury" #: lazarusidestrconsts.lisnever msgid "Never" msgstr "" #: lazarusidestrconsts.lisnew msgid "new" msgstr "nový" #: lazarusidestrconsts.lisnewancestors msgid "New Ancestors" msgstr "Nový předek" #: lazarusidestrconsts.lisnewclass msgid "New Class" msgstr "Nová třída" #: lazarusidestrconsts.lisnewconsoleapplication msgid "New console application" msgstr "Nová konzolová aplikace" #: lazarusidestrconsts.lisnewcreateanewcgiapplicationtheprogramfileismaintained msgid "Create a new cgi application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou cgi aplikaci.%sProgramový soubor je spravován Lazarusem." #: lazarusidestrconsts.lisnewdlgcreateanewcustomprogram msgid "Create a new program." msgstr "Vytvořit nový program." #: lazarusidestrconsts.lisnewdlgcreateaneweditorfilechooseatype msgid "Create a new editor file.%sChoose a type." msgstr "Vytvořit nový editovaný soubor.%sVyberte typ." #: lazarusidestrconsts.lisnewdlgcreateanewemptytextfile msgid "Create a new empty text file." msgstr "Vytvořit prázdný textový soubor." #: lazarusidestrconsts.lisnewdlgcreateanewgraphicalapplication msgid "Create a new graphical application.%sThe program file is maintained by Lazarus." msgstr "Vytvořit novou grafickou aplikaci.%sSoubor programu je spravován Lazarusem." #: lazarusidestrconsts.lisnewdlgcreateanewpascalunit msgid "Create a new pascal unit." msgstr "Vytvořit novou pascalovskou jednotku." #: lazarusidestrconsts.lisnewdlgcreateanewprogram msgid "Create a new program.%sThe program file is maintained by Lazarus." msgstr "Vytvořit nový program.%sSoubor programu je spravován Lazarusem." #: lazarusidestrconsts.lisnewdlgcreateanewprojectchooseatype msgid "Create a new project.%sChoose a type." msgstr "Vytvořit nový projekt.%sVyberte typ." #: lazarusidestrconsts.lisnewdlgcreateanewstandardpackageapackageisacollectionofun msgid "Create a new standard package.%sA package is a collection of units and components." msgstr "Vytvořit nový vzorový balíček.%sBalíček je sada jednotek a komponent." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithadatamodule msgid "Create a new unit with a datamodule." msgstr "Vytvořit novou jednotku s datovým modulem." #: lazarusidestrconsts.lisnewdlgcreateanewunitwithaframe msgid "Create a new unit with a frame" msgstr "Vytvořit novou jednotku s rámcem" #: lazarusidestrconsts.lisnewdlgcreateanewunitwithalclform msgid "Create a new unit with a LCL form." msgstr "Vytvořit novou jednotku s formulářem LCL." #: lazarusidestrconsts.lisnewdlginheritanexistingcomponent msgid "Inherit from an existing component." msgstr "Zdědit z existující komponenty." #: lazarusidestrconsts.lisnewdlgnoitemselected msgid "No item selected" msgstr "Nevybrány žádné položky" #: lazarusidestrconsts.lisnewdlgpleaseselectanitemfirst msgid "Please select an item first." msgstr "Prosíme nejdříve vyberte položku." #: lazarusidestrconsts.lisnewencoding msgid "New encoding:" msgstr "Nové kódování:" #: lazarusidestrconsts.lisnewproject msgid "%s - (new project)" msgstr "%s - (nový projekt)" #: lazarusidestrconsts.lisnewunitsareaddedtousessections msgid "New units are added to uses sections:" msgstr "" #: lazarusidestrconsts.lisno msgid "No" msgstr "Ne" #: lazarusidestrconsts.lisnobackupfiles msgid "No backup files" msgstr "Nezálohovat soubory" #: lazarusidestrconsts.lisnochange msgid "No change" msgstr "Žádné změny" #: lazarusidestrconsts.lisnocodeselected msgid "No code selected" msgstr "Nevybraný žádný kód" #: lazarusidestrconsts.lisnocompileroptionsinherited msgid "No compiler options inherited." msgstr "Nezděděny žádné volby překladače " #: lazarusidestrconsts.lisnoidewindowselected msgid "No IDE window selected" msgstr "Nevybráno žádné okno IDE" #: lazarusidestrconsts.lisnoname msgid "noname" msgstr "bezejmenný" #: lazarusidestrconsts.lisnone msgid "%snone" msgstr "%sžádný" #: lazarusidestrconsts.lisnone2 msgid "none" msgstr "žádné" #: lazarusidestrconsts.lisnonodeselected msgid "no node selected" msgstr "žádný uzel nevybrán" #: lazarusidestrconsts.lisnoprogramfilesfound msgid "No program file %s%s%s found." msgstr "Nenalezen žádný programový soubor %s%s%s." #: lazarusidestrconsts.lisnoresourcestringsectionfound msgid "No ResourceString Section found" msgstr "Nenalezen žádný výběr ResourceStringu" #: lazarusidestrconsts.lisnormallythefilterisaregularexpressioninsimplesynta msgid "Normally the filter is a regular expression. In Simple Syntax a . is a normal character, a * stands for anything, a ? stands for any character, and comma and semicolon separates alternatives. For example: Simple Syntax *.pas;*.pp corresponds to ^(.*\\.pas|.*\\.pp)$" msgstr "Obyčejně je filtr regulární výraz. V jednoduché syntaxi je . obyčejný znak, * znamená cokoliv, ? znamená jakýkoliv znak a čárka a středník oddělují varianty. Např. Jednoduché syntaxi *.pas;*.pp odpovídá ^(.*\\.pas|.*\\.pp)$" #: lazarusidestrconsts.lisnostringconstantfound msgid "No string constant found" msgstr "Nenalezeny žádné konstantní řetězce." #: lazarusidestrconsts.lisnotadelphiproject msgid "Not a Delphi project" msgstr "Není projekt Delphi" #: lazarusidestrconsts.lisnotadelphiunit msgid "Not a Delphi unit" msgstr "Není jednotka Delphi" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforfreepascal msgid "NOTE: Could not create Define Template for Free Pascal Sources" msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Free Pascalu" #: lazarusidestrconsts.lisnotecouldnotcreatedefinetemplateforlazarussources msgid "NOTE: Could not create Define Template for Lazarus Sources" msgstr "POZNÁMKA: Nelze vytvořit definiční šablonu pro zdroje Lazarusu" #: lazarusidestrconsts.lisnotimplemented msgid "Not implemented" msgstr "Doposud neimplementováno" #: lazarusidestrconsts.lisnotimplementedyet msgid "Not implemented yet:%s%s" msgstr "Zatím neimplementováno:%s%s" #: lazarusidestrconsts.lisnotimplementedyet2 msgid "Not implemented yet." msgstr "Doposud neimplementováno." #: lazarusidestrconsts.lisnotnow msgid "Not now" msgstr "Nyní ne" #: lazarusidestrconsts.lisnpcreate msgid "Create" msgstr "Vytvořit" #: lazarusidestrconsts.lisnpcreateanewproject msgid "Create a new project" msgstr "Vytvořit nový projekt" #: lazarusidestrconsts.lisnpselectaprojecttype msgid "Select a project type" msgstr "Vyberte typ projektu" #: lazarusidestrconsts.lisnumberoffilestoconvert msgid "Number of files to convert: %s" msgstr "Počet souborů k převodu: %s" #: lazarusidestrconsts.lisobjectpascaldefault msgid "Object Pascal - default" msgstr "Object Pascal - výchozí" #: lazarusidestrconsts.lisobjectpath msgid "object path" msgstr "cesta objektu" #: lazarusidestrconsts.lisoff msgid "? (Off)" msgstr "? (Vypnuto)" #: lazarusidestrconsts.lisoifaddtofavouriteproperties msgid "Add to favourite properties" msgstr "Přidat do oblíbených vlastností" #: lazarusidestrconsts.lisoifchooseabaseclassforthefavouriteproperty msgid "Choose a base class for the favourite property %s%s%s." msgstr "Vyberte základní třídu pro oblíbené vlastnosti %s%s%s." #: lazarusidestrconsts.lisoifclassnotfound msgid "Class %s%s%s not found." msgstr "Třída %s%s%s nenalezena," #: lazarusidestrconsts.lisoifremovefromfavouriteproperties msgid "Remove from favourite properties" msgstr "Odebrat z oblíbených vlastností" #: lazarusidestrconsts.lisoipautoinstalldynamic msgid "auto install dynamic" msgstr "automaticky instaluj dynamické" #: lazarusidestrconsts.lisoipautoinstallstatic msgid "auto install static" msgstr "automaticky instaluj statické" #: lazarusidestrconsts.lisoipdescription msgid "Description: " msgstr "Popis: " #: lazarusidestrconsts.lisoipdescriptiondescription msgid "%sDescription: %s" msgstr "%sPopis: %s" #: lazarusidestrconsts.lisoipfilename msgid "Filename: %s" msgstr "Jméno souboru: %s" #: lazarusidestrconsts.lisoipinstalleddynamic msgid "installed dynamic" msgstr "instalováno dynamicky" #: lazarusidestrconsts.lisoipinstalledstatic msgid "installed static" msgstr "instalováno staticky" #: lazarusidestrconsts.lisoipmissing msgid "missing" msgstr "chybějící" #: lazarusidestrconsts.lisoipmodified msgid "modified" msgstr "změněný" #: lazarusidestrconsts.lisoipnopackageselected msgid "No package selected" msgstr "Nevybrán žádný balíček" #: lazarusidestrconsts.lisoipopenloadedpackage msgid "Open loaded package" msgstr "Otevřít načtený balíček" #: lazarusidestrconsts.lisoippackagename msgid "Package Name" msgstr "Jméno balíčku" #: lazarusidestrconsts.lisoippleaseselectapackage msgid "Please select a package" msgstr "Prosím vyberte balíček" #: lazarusidestrconsts.lisoippleaseselectapackagetoopen msgid "Please select a package to open" msgstr "Prosím vyberte balíček k otevření" #: lazarusidestrconsts.lisoipreadonly msgid "readonly" msgstr "pouze pro čtení" #: lazarusidestrconsts.lisoipstate msgid "State" msgstr "Stav" #: lazarusidestrconsts.lisoipthispackageisinstalledbutthelpkfilewasnotfound msgid "%sThis package is installed, but the lpk file was not found" msgstr "%sTento balíček je nainstalován, ale lpk soubor nebyl nalezen" #: lazarusidestrconsts.lisoipthispackagewasautomaticallycreated msgid "%sThis package was automatically created" msgstr "%sTento balíček byl vytvořen automaticky" #: lazarusidestrconsts.lisok msgid "&Ok" msgstr "&Ok" #: lazarusidestrconsts.lisold msgid "old" msgstr "starý" #: lazarusidestrconsts.lisoldancestors msgid "Old Ancestors" msgstr "Starý předek" #: lazarusidestrconsts.lisoldclass msgid "Old Class" msgstr "Stará třída" #: lazarusidestrconsts.lison msgid "? (On)" msgstr "? (Zapnuto)" #: lazarusidestrconsts.lisonlysearchforwholewords msgid "Only search for whole words" msgstr "Hledat pouze celá slova" #: lazarusidestrconsts.lisopenasxmlfile msgid "Open as XML file" msgstr "Otevřít jako XML soubor" #: lazarusidestrconsts.lisopenexistingfile msgid "Open existing file" msgstr "Otevřít existující soubor" #: lazarusidestrconsts.lisopenfile msgid "Open file" msgstr "Otevřít soubor" #: lazarusidestrconsts.lisopenfile2 msgid "Open File ..." msgstr "Otevřít soubor..." #: lazarusidestrconsts.lisopenlfm msgid "Open %s" msgstr "Otevřít %s" #: lazarusidestrconsts.lisopenpackage msgid "Open Package?" msgstr "Otevřít balíček?" #: lazarusidestrconsts.lisopenpackage2 msgid "Open package %s" msgstr "Otevřít balíček %s" #: lazarusidestrconsts.lisopenpackagefile msgid "Open Package File" msgstr "Otevřít soubor projektu" #: lazarusidestrconsts.lisopenproject msgid "Open Project?" msgstr "Otevřít projekt?" #: lazarusidestrconsts.lisopenproject2 msgid "Open project" msgstr "Otevřít projekt" #: lazarusidestrconsts.lisopenprojectagain msgid "Open project again" msgstr "Otevřít projekt znovu" #: lazarusidestrconsts.lisopenprojectfile msgid "Open Project File" msgstr "Otevřít soubor projektu" #: lazarusidestrconsts.lisopensymlink msgid "Open symlink" msgstr "Otevřít symbolický odkaz" #: lazarusidestrconsts.lisopentarget msgid "Open target" msgstr "Otevřít cíl" #: lazarusidestrconsts.lisopenthefileasnormalsource msgid "Open the file as normal source" msgstr "Otevřít soubor jako normální zdrojový soubor" #: lazarusidestrconsts.lisopenthepackage msgid "Open the package %s?" msgstr "Otevřít balíček %s?" #: lazarusidestrconsts.lisopentheproject msgid "Open the project %s?" msgstr "Otevřít projekt %s?" #: lazarusidestrconsts.lisor msgid "or" msgstr "nebo" #: lazarusidestrconsts.lisoriginalfilename msgid "Original File Name:" msgstr "Původní jméno souboru:" #: lazarusidestrconsts.lisoverridelanguage msgid "Override language. For example --language=de. For possible values see files in the languages directory." msgstr "Vybrat jazyk. Na příklad --language=cz. Pro možné varinaty se podívejte na soubory ve složce jazyků." #: lazarusidestrconsts.lisoverridethedefaultcompileregppc386ppcx64ppcppcetcd msgid "%soverride the default compiler. e.g. ppc386 ppcx64 ppcppc etc. default is stored in environmentoptions.xml" msgstr "%spřepíše výchozí překladač. např. ppc386 ppcx64 ppcppc aj. výchozí je uložen v environmentoptions.xml" #: lazarusidestrconsts.lisoverridetheprojectcpuegi386x86_64powerpcpowerpc_64 msgid "%soverride the project cpu. e.g. i386 x86_64 powerpc powerpc_64 etc. default: %s" msgstr "%spřepíše cpu projektu. např. i386 x86_64 powerpc powerpc_64 aj. výchozí: %s" #: lazarusidestrconsts.lisoverridetheprojectoperatingsystemegwin32linuxdefau msgid "%soverride the project operating system. e.g. win32 linux. default: %s" msgstr "%přepíše operační systém projektu. např. win32 linux. výchozí: %s" #: lazarusidestrconsts.lisoverridetheprojectwidgetseteggtkgtk2qtwin32carbond msgid "%soverride the project widgetset. e.g. gtk gtk2 qt win32 carbon. default: %s" msgstr "%spřepíše sadu widgetů projektu. např. gtk gtk2 qt win32 carbon. výchozí: %s" #: lazarusidestrconsts.lisoverwritefile msgid "Overwrite file?" msgstr "Přepsat soubor?" #: lazarusidestrconsts.lisoverwritefileondisk msgid "Overwrite file on disk" msgstr "Přepsat soubor na disku" #: lazarusidestrconsts.lispackage msgid "Package" msgstr "Balíček" #: lazarusidestrconsts.lispackageinfo msgid "Package Info" msgstr "Informace balíčku" #: lazarusidestrconsts.lispackagenamebeginswith msgid "Package name begins with ..." msgstr "Jméno balíčku začíná s..." #: lazarusidestrconsts.lispackagenamecontains msgid "Package name contains ..." msgstr "Jméno balíčku obsahuje..." #: lazarusidestrconsts.lispackageneedsinstallation msgid "Package needs installation" msgstr "Balíček vyžaduje instalaci" #: lazarusidestrconsts.lispackagestoinstallintheide msgid "Packages to install in the IDE" msgstr "Balíčky k insalování do IDE" #: lazarusidestrconsts.lispascalsourcefile msgid "Pascal source file" msgstr "Zdrojový soubor Pascalu" #: lazarusidestrconsts.lispascalunit msgid "Pascal unit" msgstr "Pascalovský jednotka" #: lazarusidestrconsts.lispasscount msgid "Pass Count" msgstr "Počet průchodů" #: lazarusidestrconsts.lispath msgid "Path" msgstr "Cesta" #: lazarusidestrconsts.lispatheditbrowse msgid "Browse" msgstr "Procházet" #: lazarusidestrconsts.lispatheditmovepathdown msgid "Move path down" msgstr "Posunout cestu dolů" #: lazarusidestrconsts.lispatheditmovepathup msgid "Move path up" msgstr "Posunout cestu nahoru" #: lazarusidestrconsts.lispatheditpathtemplates msgid "Path templates" msgstr "Šablony cest" #: lazarusidestrconsts.lispatheditsearchpaths msgid "Search paths:" msgstr "Hledat cesty:" #: lazarusidestrconsts.lispatheditselectdirectory msgid "Select directory" msgstr "Hledat adresář" #: lazarusidestrconsts.lispckeditaddanitem msgid "Add an item" msgstr "Přidat položku" #: lazarusidestrconsts.lispckeditaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts.lispckeditapplychanges msgid "Apply changes" msgstr "Použít změny" #: lazarusidestrconsts.lispckeditcallregisterprocedureofselectedunit msgid "Call %sRegister%s procedure of selected unit" msgstr "Volání %sRegistr%s procedura vybrané jednotky" #: lazarusidestrconsts.lispckeditcleardependencydefaultfilename msgid "Clear dependency filename" msgstr "Smazat jméno závislého souboru" #: lazarusidestrconsts.lispckeditcompile msgid "Compile" msgstr "Přeložit" #: lazarusidestrconsts.lispckeditcompileeverything msgid "Compile everything?" msgstr "Přeložit vše?" #: lazarusidestrconsts.lispckeditcompilepackage msgid "Compile package" msgstr "Kompilovat balíček" #: lazarusidestrconsts.lispckeditcompileroptionsforpackage msgid "Compiler Options for Package %s" msgstr "Volby překladače pro balíček %s" #: lazarusidestrconsts.lispckeditcompopts msgid "Compiler Options" msgstr "Volby překladače" #: lazarusidestrconsts.lispckeditcreatemakefile msgid "Create Makefile" msgstr "Vytvořit Makefile" #: lazarusidestrconsts.lispckeditdependencyproperties msgid "Dependency Properties" msgstr "Vlastnsoti závislosti" #: lazarusidestrconsts.lispckediteditgeneraloptions msgid "Edit General Options" msgstr "Upravit obecné nastavení" #: lazarusidestrconsts.lispckediteditoptionstocompilepackage msgid "Edit Options to compile package" msgstr "Upravit nastavení pro překlad balíčku" #: lazarusidestrconsts.lispckeditfileproperties msgid "File Properties" msgstr "Vlastnosti souboru" #: lazarusidestrconsts.lispckeditgeneraloptions msgid "General Options" msgstr "Obecná nastavení" #: lazarusidestrconsts.lispckedithelp msgid "Help" msgstr "Nápověda" #: lazarusidestrconsts.lispckeditinstall msgid "Install" msgstr "Instalovat" #: lazarusidestrconsts.lispckeditinstallpackageintheide msgid "Install package in the IDE" msgstr "Instalovat balíček do IDE" #: lazarusidestrconsts.lispckeditinvalidmaximumversion msgid "Invalid maximum version" msgstr "Neplatná maximální verze" #: lazarusidestrconsts.lispckeditinvalidminimumversion msgid "Invalid minimum version" msgstr "Neplatná minimální verze" #: lazarusidestrconsts.lispckeditmaximumversion msgid "Maximum Version:" msgstr "Maximální verze:" #: lazarusidestrconsts.lispckeditminimumversion msgid "Minimum Version:" msgstr "Minimální verze:" #: lazarusidestrconsts.lispckeditmodified msgid "Modified: %s" msgstr "Změněný: %s" #: lazarusidestrconsts.lispckeditmore msgid "More ..." msgstr "Více..." #: lazarusidestrconsts.lispckeditmovedependencydown msgid "Move dependency down" msgstr "Posunout závislost dolů" #: lazarusidestrconsts.lispckeditmovedependencyup msgid "Move dependency up" msgstr "Posunout závislost nahoru" #: lazarusidestrconsts.lispckeditpackage msgid "Package %s" msgstr "Balíček %s" #: lazarusidestrconsts.lispckeditpackagehaschangedsavepackage msgid "Package %s%s%s has changed.%sSave package?" msgstr "Balíček %s%s%s byl změněn.%sUložit balíček?" #: lazarusidestrconsts.lispckeditpackagenotsaved msgid "package %s not saved" msgstr "balíček %s nenalezen" #: lazarusidestrconsts.lispckeditpage msgid "%s, Page: %s" msgstr "%s,Stránka: %s" #: lazarusidestrconsts.lispckeditreadddependency msgid "Re-Add dependency" msgstr "Znovu přidat závislost" #: lazarusidestrconsts.lispckeditreaddfile msgid "Re-Add file" msgstr "Znovu přidat soubor" #: lazarusidestrconsts.lispckeditreadonly msgid "Read Only: %s" msgstr "Pouze pro čtení: %s" #: lazarusidestrconsts.lispckeditrecompileallrequired msgid "Recompile all required" msgstr "Znovupřeložit vše potřebné" #: lazarusidestrconsts.lispckeditrecompileclean msgid "Recompile clean" msgstr "Znovupřeložit načisto" #: lazarusidestrconsts.lispckeditrecompilethisandallrequiredpackages msgid "Re-Compile this and all required packages?" msgstr "Znovu přeložit tento a všechny požadované balíčky?" #: lazarusidestrconsts.lispckeditregisteredplugins msgid "Registered plugins" msgstr "Registrované zásuvné moduly" #: lazarusidestrconsts.lispckeditregisterunit msgid "Register unit" msgstr "Registrovat jednotku" #: lazarusidestrconsts.lispckeditremovedependency msgid "Remove dependency" msgstr "Odstranit závislost" #: lazarusidestrconsts.lispckeditremovedependency2 msgid "Remove Dependency?" msgstr "Odstranit závislost?" #: lazarusidestrconsts.lispckeditremovedependencyfrompackage msgid "Remove dependency %s%s%s%sfrom package %s%s%s?" msgstr "Odstranit závislost %s%s%s%sz balíčku %s%s%s?" #: lazarusidestrconsts.lispckeditremovedfilestheseentriesarenotsavedtothelpkfile msgid "Removed Files (these entries are not saved to the lpk file)" msgstr "Odstranit soubory (tyto položky nejsou ukládány do souboru lpk)" #: lazarusidestrconsts.lispckeditremovedrequiredpackagestheseentriesarenotsaved msgid "Removed required packages (these entries are not saved to the lpk file)" msgstr "Odstranit požadované balíčky (tyto položky nejsou uloženy do souboru lpk)" #: lazarusidestrconsts.lispckeditremovefile msgid "Remove file" msgstr "Odstranit soubor" #: lazarusidestrconsts.lispckeditremovefile2 msgid "Remove file?" msgstr "Odstranit soubor?" #: lazarusidestrconsts.lispckeditremovefilefrompackage msgid "Remove file %s%s%s%sfrom package %s%s%s?" msgstr "Odstranit soubor %s%s%s%sz balíčku %s%s%s?" #: lazarusidestrconsts.lispckeditremoveselecteditem msgid "Remove selected item" msgstr "Odstranit vybrané položky" #: lazarusidestrconsts.lispckeditrequiredpackages msgid "Required Packages" msgstr "Požadované balíčky" #: lazarusidestrconsts.lispckeditsavechanges msgid "Save Changes?" msgstr "Uložit změny?" #: lazarusidestrconsts.lispckeditsavepackage msgid "Save package" msgstr "Uložit balíček" #: lazarusidestrconsts.lispckeditsetdependencydefaultfilename msgid "Store dependency filename" msgstr "Uložit jméno souboru závislosti" #: lazarusidestrconsts.lispckeditthemaximumversionisnotavalidpackageversion msgid "The maximum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "Maximální verze %s%s%s není platná verze balíčku.%s(dobrý příklad 1.2.3.4)" #: lazarusidestrconsts.lispckedittheminimumversionisnotavalidpackageversion msgid "The minimum version %s%s%s is not a valid package version.%s(good example 1.2.3.4)" msgstr "Minimální verze %s%s%s není platná verze balíčku.%s(dobrý příklad 1.2.3.4)" #: lazarusidestrconsts.lispckedituninstall msgid "Uninstall" msgstr "Odinstalovat" #: lazarusidestrconsts.lispckeditviewpackgesource msgid "View Package Source" msgstr "Zobrazit zdroj balíkču" #: lazarusidestrconsts.lispckexplautocreated msgid "AutoCreated" msgstr "Automaticky vytvořeno" #: lazarusidestrconsts.lispckexplinstalled msgid "Installed" msgstr "Instalováno" #: lazarusidestrconsts.lispckexplinstallonnextstart msgid "Install on next start" msgstr "Instalovat při dalším spuštění" #: lazarusidestrconsts.lispckexplisrequiredby msgid "Selected package is required by:" msgstr "Vybraný balíček je požadován:" #: lazarusidestrconsts.lispckexplloadedpackages msgid "Loaded Packages:" msgstr "Načtené balíčky:" #: lazarusidestrconsts.lispckexplpackagenotfound msgid "Package %s not found" msgstr "Balíček %s nenalezen" #: lazarusidestrconsts.lispckexplstate msgid "%sState: " msgstr "%sStav: " #: lazarusidestrconsts.lispckexpluninstallonnextstart msgid "Uninstall on next start" msgstr "Odinstalovat při dalším spuštění" #: lazarusidestrconsts.lispckoptsaddoptionstodependentpackagesandprojects msgid "Add options to dependent packages and projects" msgstr "Přidat volby do závislých balíčků a projektů" #: lazarusidestrconsts.lispckoptsaddpathstodependentpackagesprojects msgid "Add paths to dependent packages/projects" msgstr "Přidat cesty do závislých balíčků/projektů" #: lazarusidestrconsts.lispckoptsauthor msgid "Author:" msgstr "Autor:" #: lazarusidestrconsts.lispckoptsautomaticallyincrementversiononbuild msgid "Automatically increment version on build" msgstr "Automaticky zvyšovat číslo verze při sestavení" #: lazarusidestrconsts.lispckoptsautomaticallyrebuildasneeded msgid "Automatically rebuild as needed" msgstr "Automaticky znovu sestavit podle potřeby" #: lazarusidestrconsts.lispckoptsautorebuildwhenrebuildingall msgid "Auto rebuild when rebuilding all" msgstr "Automaticky znovu sestav pokud znovu sestavení všeho" #: lazarusidestrconsts.lispckoptscustom msgid "Custom" msgstr "Vlastní" #: lazarusidestrconsts.lispckoptsdescriptionabstract msgid "Description/Abstract" msgstr "Popis/obsah" #: lazarusidestrconsts.lispckoptsdesigntimeandruntime msgid "Designtime and Runtime" msgstr "Doba návrhu a doba kompilace" #: lazarusidestrconsts.lispckoptsdesigntimeonly msgid "Designtime only" msgstr "Pouze doba návrhu" #: lazarusidestrconsts.lispckoptsideintegration msgid "IDE Integration" msgstr "Integrace IDE" #: lazarusidestrconsts.lispckoptsinclude msgid "Include" msgstr "Zahrnout" #: lazarusidestrconsts.lispckoptsinvalidpackagetype msgid "Invalid package type" msgstr "Neplatný typ balíčku" #: lazarusidestrconsts.lispckoptslazdoclazarusdocumentation msgid "FPDoc files path" msgstr "Cesta souborů FPDoc" #: lazarusidestrconsts.lispckoptslibrary msgid "Library" msgstr "Knihovna" #: lazarusidestrconsts.lispckoptslicense msgid "License:" msgstr "Licence:" #: lazarusidestrconsts.lispckoptslinker msgid "Linker" msgstr "Spojovací program" #: lazarusidestrconsts.lispckoptsmajor msgid "Major" msgstr "Hlavní" #: lazarusidestrconsts.lispckoptsmanualcompilationneverautomatically msgid "Manual compilation (never automatically)" msgstr "Ruční překlad (nikdy automaticky)" #: lazarusidestrconsts.lispckoptsminor msgid "Minor" msgstr "Minoritní" #: lazarusidestrconsts.lispckoptsobject msgid "Object" msgstr "Objekt" #: lazarusidestrconsts.lispckoptspackageoptions msgid "Package Options" msgstr "Nastavení balíčku" #: lazarusidestrconsts.lispckoptspackagetype msgid "PackageType" msgstr "Typ balíčku" #: lazarusidestrconsts.lispckoptsprovides msgid "Provides" msgstr "Poskytuje" #: lazarusidestrconsts.lispckoptsrelease msgid "Release" msgstr "Uvolnění" #: lazarusidestrconsts.lispckoptsruntimeonly msgid "Runtime only" msgstr "Pouze běhový" #: lazarusidestrconsts.lispckoptsthepackagehastheautoinstallflagthismeans msgid "The package %s%s%s has the auto install flag.%sThis means it will be installed in the IDE. Installation packages%smust be designtime Packages." msgstr "Balíček %s%s% má vlajku autoinstalace.%sTo znamená, že bude instalován do IDE. Instalované balíčky musí" #: lazarusidestrconsts.lispckoptsthispackageprovidesthesameasthefollowingpackages msgid "This package provides the same as the following packages:" msgstr "Tento balíček poskytuje to samé jako následující balíčky:" #: lazarusidestrconsts.lispckoptsupdaterebuild msgid "Update/Rebuild" msgstr "Aktualizovat/Znovu sestavit" #: lazarusidestrconsts.lispckoptsusage msgid "Usage" msgstr "Použití" #: lazarusidestrconsts.lispdabort msgid "Abort" msgstr "Přerušit" #: lazarusidestrconsts.lispdprogress msgid "Progress" msgstr "Průběh" #: lazarusidestrconsts.lispeapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts.lispeconflictfound msgid "Conflict found" msgstr "Nalezen konflikt" #: lazarusidestrconsts.lispeeditvirtualunit msgid "Edit Virtual Unit" msgstr "Upravit virtuální jednotku" #: lazarusidestrconsts.lispefilename msgid "Filename:" msgstr "Jméno souboru:" #: lazarusidestrconsts.lispefixfilescase msgid "Fix Files Case" msgstr "Opravit velikost písmen souborů" #: lazarusidestrconsts.lispeinvalidunitfilename msgid "Invalid unit filename" msgstr "Neplatné jméno souboru jednotky" #: lazarusidestrconsts.lispeinvalidunitname msgid "Invalid unitname" msgstr "Neplatné jméno jednotky" #: lazarusidestrconsts.lispemovefiledown msgid "Move file down" msgstr "Posunout soubor dolů" #: lazarusidestrconsts.lispemovefileup msgid "Move file up" msgstr "Posunout soubor nahoru" #: lazarusidestrconsts.lispesortfiles msgid "Sort files" msgstr "Řadit soubory" #: lazarusidestrconsts.lispethereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "Již existuje jednotka s tímto jménem.%sSoubor: %s" #: lazarusidestrconsts.lispetheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "Jméno jednotky není platný pascalovský identifikátor." #: lazarusidestrconsts.lispetheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "Jméno jednotky je použito, když IDE rozšiřuje definici uses." #: lazarusidestrconsts.lispeunitname msgid "Unitname:" msgstr "Jméno jednotky:" #: lazarusidestrconsts.lispeunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts.lispeviewtodolist msgid "View ToDo list" msgstr "Zobrazit seznam úkolů" #: lazarusidestrconsts.lispkgdefscompiledsrcpathaddition msgid "CompiledSrcPath addition" msgstr "Doplněk CompiledSrcPath" #: lazarusidestrconsts.lispkgdefsoutputdirectory msgid "Output directory" msgstr "Výstupní adresář" #: lazarusidestrconsts.lispkgdefssrcdirmark msgid "Package Source Directory Mark" msgstr "Značka zdrojového adresáře balíčku" #: lazarusidestrconsts.lispkgdefsunitpath msgid "Unit Path" msgstr "Cesta jednotky" #: lazarusidestrconsts.lispkgeditdoyoureallywanttoforgetallchangestopackageand msgid "Do you really want to forget all changes to package %s and reload it from file?" msgstr "Chcete zapomenout všechny změny v balíčku %s a načíst ho ze souboru?" #: lazarusidestrconsts.lispkgeditnewunitnotinunitpath msgid "New unit not in unitpath" msgstr "Nová jednotka není v cestě jednotek" #: lazarusidestrconsts.lispkgeditpublishpackage msgid "Publish Package" msgstr "Vydat balíček" #: lazarusidestrconsts.lispkgeditrevertpackage msgid "Revert package?" msgstr "Navrátit balíček?" #: lazarusidestrconsts.lispkgeditthefileiscurrentlynotintheunitpathofthepackage msgid "The file %s%s%s%sis currently not in the unitpath of the package.%s%sAdd %s%s%s to UnitPath?" msgstr "Soubor %s%s%s%snení aktuálně v cestě jednotek balíčku.%s%sPřidat %s%s%s do UnitPath?" #: lazarusidestrconsts.lispkgedonlinehelpnotyetimplemented msgid "Online Help not yet implemented" msgstr "Online nápověda zatím neimplementována" #: lazarusidestrconsts.lispkgedrightclickontheitemstreetogetthepopupmenuwithallav msgid "Right click on the items tree to get the popupmenu with all available package functions." msgstr "" #: lazarusidestrconsts.lispkgedtherearemorefunctionsinthepopupmenu msgid "There are more functions in the popupmenu" msgstr "V roletovém menu je více funkcí" #: lazarusidestrconsts.lispkgfiletypebinary msgid "Binary" msgstr "Binární" #: lazarusidestrconsts.lispkgfiletypeinclude msgid "Include file" msgstr "" #: lazarusidestrconsts.lispkgfiletypeissues msgid "Issues xml file" msgstr "" #: lazarusidestrconsts.lispkgfiletypelfm msgid "LFM - Lazarus form text" msgstr "LFM - Text formuláře Lazarusu" #: lazarusidestrconsts.lispkgfiletypelrs msgid "LRS - Lazarus resource" msgstr "LRS - Zdrojový soubor Lazarusu" #: lazarusidestrconsts.lispkgfiletypetext msgid "Text" msgstr "Text" #: lazarusidestrconsts.lispkgfiletypeunit msgid "Unit" msgstr "Jednotka" #: lazarusidestrconsts.lispkgfiletypevirtualunit msgid "Virtual Unit" msgstr "Virtuální jednotka" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforpackagepackage msgid "%sAdding new Dependency for package %s: package %s%s" msgstr "%sPřidávám novou závislost pro balíček %s: balíček %s%s" #: lazarusidestrconsts.lispkgmangaddingnewdependencyforprojectpackage msgid "%sAdding new Dependency for project %s: package %s%s" msgstr "%sPřidávám novou závislost pro projekt %s: balíček %s%s" #: lazarusidestrconsts.lispkgmangaddunittousesclauseofpackagedisablethisonlyforunit msgid "Add unit to uses clause of package. Disable this only for units, that should not be compiled in all cases." msgstr "Přidat jednotku do sekce uses v balíčku. Zakaž toto pouze pro jednotky, které nebudou vždy překládány." #: lazarusidestrconsts.lispkgmangambiguousunitsfound msgid "Ambiguous units found" msgstr "Nejednoznačné jednotky nalezeny" #: lazarusidestrconsts.lispkgmangarequiredpackageswasnotfound msgid "A required packages was not found. See package graph." msgstr "Požadovaný balíkček nenalezen. Podívejte se na graf balíčků." #: lazarusidestrconsts.lispkgmangautomaticallyinstalledpackages msgid "Automatically installed packages" msgstr "Automaticky instalované balíčky" #: lazarusidestrconsts.lispkgmangbothpackagesareconnectedthismeanseitheronepackageu msgid "%sBoth packages are connected. This means, either one package uses the other, or they are both used by a third package." msgstr "%sOba balíčky jsou propojeny. To znamená, že buď jeden balíček používá druhý nebo oba jsou použity třetím balíčkem." #: lazarusidestrconsts.lispkgmangbrokendependency msgid "Broken dependency" msgstr "Porušená závislost" #: lazarusidestrconsts.lispkgmangcircleinpackagedependencies msgid "Circle in package dependencies" msgstr "Kruh v závislostech balíčků" #: lazarusidestrconsts.lispkgmangdeletefailed msgid "Delete failed" msgstr "Odstranění selhalo" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile msgid "Delete Old Package File?" msgstr "Smazat starý soubor balíčku?" #: lazarusidestrconsts.lispkgmangdeleteoldpackagefile2 msgid "Delete old package file %s%s%s?" msgstr "Odstranit starý soubor balíčku %s%s%s?" #: lazarusidestrconsts.lispkgmangdependencywithoutowner msgid "Dependency without Owner: %s" msgstr "Závislost bez vlastníka: %s" #: lazarusidestrconsts.lispkgmangerrorreadingfile msgid "Error reading file" msgstr "Chyba načítání souboru" #: lazarusidestrconsts.lispkgmangerrorreadingpackage msgid "Error Reading Package" msgstr "Chyba načítání balíčku" #: lazarusidestrconsts.lispkgmangerrorwritingfile msgid "Error writing file" msgstr "Cyba zapisování souboru" #: lazarusidestrconsts.lispkgmangerrorwritingpackage msgid "Error Writing Package" msgstr "Chyba zapisování balíčku" #: lazarusidestrconsts.lispkgmangfileisalreadyinpackage msgid "File is already in package" msgstr "Soubor je již obsažen v balíčku" #: lazarusidestrconsts.lispkgmangfileisinproject msgid "File is in Project" msgstr "Soubor je projekt" #: lazarusidestrconsts.lispkgmangfilenamediffersfrompackagename msgid "Filename differs from Packagename" msgstr "Jméno souboru se liší od jména balíčku" #: lazarusidestrconsts.lispkgmangfilenameisusedbyotherpackage msgid "Filename is used by other package" msgstr "Jméno souboru je použito jiným balíčkem" #: lazarusidestrconsts.lispkgmangfilenameisusedbyproject msgid "Filename is used by project" msgstr "Jméno souboru je použito projektem" #: lazarusidestrconsts.lispkgmangfilenotfound msgid "File %s%s%s not found." msgstr "Soubor %s%s%s nenalezen." #: lazarusidestrconsts.lispkgmangfilenotsaved msgid "File not saved" msgstr "Soubor není uložený" #: lazarusidestrconsts.lispkgmangignoreandsavepackagenow msgid "Ignore and save package now" msgstr "Nyní balíček ignorovat a uložit" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac msgid "Installing the package %s will automatically install the package:" msgstr "" #: lazarusidestrconsts.lispkgmanginstallingthepackagewillautomaticallyinstallthepac2 msgid "Installing the package %s will automatically install the packages:" msgstr "" #: lazarusidestrconsts.lispkgmanginvalidcompilerfilename msgid "invalid Compiler filename" msgstr "Neplatné jméno překladače" #: lazarusidestrconsts.lispkgmanginvalidfileextension msgid "Invalid file extension" msgstr "Neplatná přípona souboru" #: lazarusidestrconsts.lispkgmanginvalidpackagefileextension msgid "Invalid package file extension" msgstr "Neplatná přípona balíčku" #: lazarusidestrconsts.lispkgmanginvalidpackagefilename msgid "Invalid package filename" msgstr "Neplatné jméno souboru balíčku" #: lazarusidestrconsts.lispkgmanginvalidpackagename msgid "Invalid package name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts.lispkgmanginvalidpackagename2 msgid "Invalid Package Name" msgstr "Neplatné jméno balíčku" #: lazarusidestrconsts.lispkgmanglazarus msgid "Lazarus" msgstr "Lazarus" #: lazarusidestrconsts.lispkgmangloadingpackagewillreplacepackage msgid "Loading package %s will replace package %s%sfrom file %s.%sThe old package is modified.%s%sSave old package %s?" msgstr "" #: lazarusidestrconsts.lispkgmangnewpackage msgid "NewPackage" msgstr "Nový balíček" #: lazarusidestrconsts.lispkgmangpackage msgid "Package: %s" msgstr "Balík: %s" #: lazarusidestrconsts.lispkgmangpackagechangedsave msgid "Package %s%s%s changed. Save?" msgstr "Balíče %s%s%s změněn. Uložit?" #: lazarusidestrconsts.lispkgmangpackageconflicts msgid "Package conflicts" msgstr "Konflikt balíčků" #: lazarusidestrconsts.lispkgmangpackagefilemissing msgid "Package file missing" msgstr "Soubor balíčku chybí" #: lazarusidestrconsts.lispkgmangpackagefilenotsaved msgid "Package file not saved" msgstr "Soubor balíčku neuložen" #: lazarusidestrconsts.lispkgmangpackagehasnovalidoutputdirectory msgid "Package %s%s%s has no valid output directory:%s%s%s%s" msgstr "Balíček %s%s%s nemá platný výstupní adresář: %s%s%s%s" #: lazarusidestrconsts.lispkgmangpackageisnodesigntimepackage msgid "Package is no designtime package" msgstr "Balíček není návrhový balíček" #: lazarusidestrconsts.lispkgmangpackageisrequired msgid "Package is required" msgstr "Balíček je vyžadován" #: lazarusidestrconsts.lispkgmangpackagemainsourcefile msgid "package main source file" msgstr "hlavní zdrojový soubor balíčku" #: lazarusidestrconsts.lispkgmangpackagenamealreadyexists msgid "Package name already exists" msgstr "Jméno balíčku již existuje" #: lazarusidestrconsts.lispkgmangpackagesmusthavetheextensionlpk msgid "Packages must have the extension .lpk" msgstr "" #: lazarusidestrconsts.lispkgmangpleasesavethefilebeforeaddingittoapackage msgid "Please save the file before adding it to a package." msgstr "" #: lazarusidestrconsts.lispkgmangpleasesavethepackagefirst msgid "Please save the package first." msgstr "" #: lazarusidestrconsts.lispkgmangproject msgid "Project: %s" msgstr "Projekt: %s" #: lazarusidestrconsts.lispkgmangrebuildlazarus msgid "Rebuild Lazarus?" msgstr "Přestavět Lazarus?" #: lazarusidestrconsts.lispkgmangrenamefileinpackage msgid "Rename file in package?" msgstr "" #: lazarusidestrconsts.lispkgmangrenamefilelowercase msgid "Rename File lowercase?" msgstr "" #: lazarusidestrconsts.lispkgmangreplaceexistingfile msgid "Replace existing file %s%s%s?" msgstr "Nahradit existující soubor %s%s%s?" #: lazarusidestrconsts.lispkgmangreplacefile msgid "Replace File" msgstr "Nahradit soubor" #: lazarusidestrconsts.lispkgmangsavepackage msgid "Save Package?" msgstr "Uložit balíček?" #: lazarusidestrconsts.lispkgmangsavepackage2 msgid "Save package?" msgstr "Uložit balíček?" #: lazarusidestrconsts.lispkgmangsavepackagelpk msgid "Save Package %s (*.lpk)" msgstr "Uložit balíček %s (*.lpk)" #: lazarusidestrconsts.lispkgmangshouldthefilerenamedlowercaseto msgid "Should the file be renamed lowercase to%s%s%s%s?" msgstr "Měl by být soubor přejmenován na malé znaky na %s%s%s%s?" #: lazarusidestrconsts.lispkgmangskipthispackage msgid "Skip this package" msgstr "Přeskočit tento balíček" #: lazarusidestrconsts.lispkgmangstaticpackagesconfigfile msgid "static packages config file" msgstr "" #: lazarusidestrconsts.lispkgmangthecompilerfileforpackageisnotavalidexecutable msgid "The compiler file for package %s is not a valid executable:%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthefileisalreadyinthepackage msgid "The file %s%s%s%sis already in the package %s." msgstr "" #: lazarusidestrconsts.lispkgmangthefileisnotalazaruspackage msgid "The file %s%s%s is not a lazarus package." msgstr "" #: lazarusidestrconsts.lispkgmangthefilenamedoesnotcorrespondtothepackage msgid "The filename %s%s%s does not correspond to the package name %s%s%s in the file.%sChange package name to %s%s%s?" msgstr "" #: lazarusidestrconsts.lispkgmangthefilenameispartofthecurrentproject msgid "The file name %s%s%s is part of the current project.%sProjects and Packages should not share files." msgstr "" #: lazarusidestrconsts.lispkgmangthefilenameisusedbythepackageinfile msgid "The file name %s%s%s is used by%sthe package %s%s%s%sin file %s%s%s." msgstr "" #: lazarusidestrconsts.lispkgmangthefileofpackageismissing msgid "The file %s%s%s%sof package %s is missing." msgstr "" #: lazarusidestrconsts.lispkgmangthefileofpackageneedstobesavedfirst msgid "The file %s%s%s%sof package %s needs to be saved first." msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingpackagefailedtoload msgid "The following package failed to load:" msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingpackagesfailedtoload msgid "The following packages failed to load:" msgstr "" #: lazarusidestrconsts.lispkgmangthefollowingunitswillbeaddedtotheusessectionof msgid "%sThe following units will be added to the uses section of%s%s:%s%s%s" msgstr "%sNásledující jednotky budou přidány do sekce uses jednotky %s%s:%s%s%s" #: lazarusidestrconsts.lispkgmangthepackagefailedtocompileremoveitfromtheinstallati msgid "The package %s%s%s failed to compile.%sRemove it from the installation list?" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagefilenameinisnotavalidlazaruspackagename msgid "The package file name %s%s%s in%s%s%s%s is not a valid lazarus package name." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageisaruntimeonlypackageruntimeonlypackages msgid "The package %s is a runtime only package.%sRuntime only packages can not be installed in the IDE." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageismarkedforinstallationbutcannotbefound msgid "The package %s%s%s is marked for installation, but can not be found.%sRemove dependency from the installation list of packages?" msgstr "" #: lazarusidestrconsts.lispkgmangthepackageisrequiredbywhichismarkedforinstallation msgid "The package %s is required by %s, which is marked for installation.%sSee package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthepackagenameisnotavalidpackagenamepleasechoosean msgid "The package name %s%s%s is not a valid package name%sPlease choose another name (e.g. package1.lpk)" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagenameofthefileisinvalid msgid "The package name %s%s%s of%sthe file %s%s%s is invalid." msgstr "" #: lazarusidestrconsts.lispkgmangthepackageownsthefileshouldthefileberenamed msgid "The package %s owns the file%s%s%s%s.%sShould the file be renamed in the package as well?" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedcurrentlylazarus msgid "The package %s%s%s was marked.%sCurrently lazarus only supports static linked packages. The real un-installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts.lispkgmangthepackagewasmarkedforinstallationcurrentlylazarus msgid "The package %s%s%s was marked for installation.%sCurrently lazarus only supports static linked packages. The real installation needs rebuilding and restarting of lazarus.%s%sDo you want to rebuild Lazarus now?" msgstr "" #: lazarusidestrconsts.lispkgmangtheprojectrequiresthepackagebutitwasnotfound msgid "The project requires the package %s%s%s.%sBut it was not found. See Project -> Project Inspector." msgstr "" #: lazarusidestrconsts.lispkgmangtherearetwounitswiththesamename1from2from msgid "There are two units with the same name:%s%s1. %s%s%s from %s%s2. %s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisacircleintherequiredpackages msgid "There is a circle in the required packages. See package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenameasapackage msgid "There is a FPC unit with the same name as a package:%s%s%s%s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisafpcunitwiththesamenamefrom msgid "There is a FPC unit with the same name as:%s%s%s%s%s from %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisalreadyanotherpackagewiththename msgid "There is already another package with the name %s%s%s.%sConflict package: %s%s%s%sFile: %s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthereisalreadyapackageloadedfromfile msgid "There is already a package %s%s%s loaded%sfrom file %s%s%s.%sSee Components -> Package Graph.%sReplace is impossible." msgstr "" #: lazarusidestrconsts.lispkgmangthereisanunsavedpackageintherequiredpackages msgid "There is an unsaved package in the required packages. See package graph." msgstr "" #: lazarusidestrconsts.lispkgmangthereisaunitwiththesamenameasapackage1from2 msgid "There is a unit with the same name as a package:%s%s1. %s%s%s from %s%s2. %s%s%s%s" msgstr "" #: lazarusidestrconsts.lispkgmangthisfilewasautomaticallycreatedbylazarusdonotedit msgid "This file was automatically created by Lazarus. Do not edit!" msgstr "" #: lazarusidestrconsts.lispkgmangthisisavirtualpackageithasnosourceyetpleasesavethe msgid "This is a virtual package. It has no source yet. Please save the package first." msgstr "" #: lazarusidestrconsts.lispkgmangthissourceisonlyusedtocompileandinstallthepackage msgid "This source is only used to compile and install the package." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatedirectory msgid "Unable to create directory" msgstr "Nelze vytvořit adresář" #: lazarusidestrconsts.lispkgmangunabletocreateoutputdirectoryforpackage msgid "Unable to create output directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatepackagesourcedirectoryforpackage msgid "Unable to create package source directory %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletocreatetargetdirectoryforlazarus msgid "Unable to create target directory for lazarus:%s%s%s%s.%sThis directory is needed for the new changed lazarus IDE with your custom packages." msgstr "" #: lazarusidestrconsts.lispkgmangunabletodeletefile msgid "Unable to delete file %s%s%s." msgstr "Nelze smazat soubor %s%s%s." #: lazarusidestrconsts.lispkgmangunabletodeletefilename msgid "Unable to delete file" msgstr "Nelze smazat soubor" #: lazarusidestrconsts.lispkgmangunabletodeleteoldstatefileforpackage msgid "Unable to delete old state file %s%s%s%sfor package %s." msgstr "" #: lazarusidestrconsts.lispkgmangunabletoloadpackage msgid "Unable to load package" msgstr "Nelze načíst balíček" #: lazarusidestrconsts.lispkgmangunabletoopenthepackage msgid "Unable to open the package %s%s%s.%sThis package was marked for installation." msgstr "Nelze otevřít balíček %s%s%s.%sTento balíček byl označen k instalaci." #: lazarusidestrconsts.lispkgmangunabletoreadstatefileofpackageerror msgid "Unable to read state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmangunabletowritepackagetofileerror msgid "Unable to write package %s%s%s%sto file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmangunabletowritestatefileofpackageerror msgid "Unable to write state file %s%s%s%sof package %s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispkgmanguninstallpackage msgid "Uninstall package?" msgstr "Odinstalovat balíček?" #: lazarusidestrconsts.lispkgmanguninstallpackage2 msgid "Uninstall package %s?" msgstr "Odinstalovat balíček %s?" #: lazarusidestrconsts.lispkgmangunsavedpackage msgid "Unsaved package" msgstr "Neuložený balíček" #: lazarusidestrconsts.lispkgmanguseunit msgid "Use unit" msgstr "Požít jednotku" #: lazarusidestrconsts.lispkgmangwarningthefilebelongstothecurrentproject msgid "Warning: The file %s%s%s%sbelongs to the current project." msgstr "Varování: Soubor %s%s%s%spatří k aktuálnímu projektu." #: lazarusidestrconsts.lispkgreg msgid "Package Registration" msgstr "Registrace balíčku" #: lazarusidestrconsts.lispkgsyscannotregistercomponentswithoutunit msgid "Can not register components without unit" msgstr "Nelze registrovat komponenty bez jednotky" #: lazarusidestrconsts.lispkgsyscodetoolstoolsandfunctionstoparsebrowseandeditpasc msgid "CodeTools - tools and functions to parse, browse and edit pascal sources" msgstr "" #: lazarusidestrconsts.lispkgsyscomponentclassalreadydefined msgid "Component Class %s%s%s already defined" msgstr "Třída komponenty %s%s%s je již definována." #: lazarusidestrconsts.lispkgsysfilename msgid "%s%sFile Name: %s%s%s" msgstr "%s%sJméno souboru: %s%s%s" #: lazarusidestrconsts.lispkgsysinvalidcomponentclass msgid "Invalid component class" msgstr "" #: lazarusidestrconsts.lispkgsysinvalidunitname msgid "Invalid Unitname: %s" msgstr "" #: lazarusidestrconsts.lispkgsyspackagefilenotfound msgid "Package file not found" msgstr "Soubor balíčku nenalezen" #: lazarusidestrconsts.lispkgsysregisterprocedureisnil msgid "Register procedure is nil" msgstr "Registrační procedura je nil" #: lazarusidestrconsts.lispkgsysregisterunitwascalledbutnopackageisregistering msgid "RegisterUnit was called, but no package is registering." msgstr "" #: lazarusidestrconsts.lispkgsysregistrationerror msgid "Registration Error" msgstr "Chyba registrace" #: lazarusidestrconsts.lispkgsyssynedittheeditorcomponentusedbylazarus msgid "SynEdit - the editor component used by Lazarus. http://sourceforge.net/projects/synedit/" msgstr "" #: lazarusidestrconsts.lispkgsysthefclfreepascalcomponentlibraryprovidesthebase msgid "The FCL - FreePascal Component Library provides the base classes for object pascal." msgstr "" #: lazarusidestrconsts.lispkgsysthelcllazaruscomponentlibrarycontainsallbase msgid "The LCL - Lazarus Component Library contains all base components for form editing." msgstr "" #: lazarusidestrconsts.lispkgsysthepackageisinstalledbutnovalidpackagefilewasfound msgid "The package %s%s%s is installed, but no valid package file (.lpk) was found.%sA broken dummy package was created." msgstr "" #: lazarusidestrconsts.lispkgsysthertlfreepascalcomponentlibraryprovidesthebase msgid "The RTL - The Run-Time Library is the basis of all Free Pascal programs." msgstr "" #: lazarusidestrconsts.lispkgsysthisisthedefaultpackageusedonlyforcomponents msgid "This is the default package. Used only for components without a package. These components are outdated." msgstr "" #: lazarusidestrconsts.lispkgsysthispackageisinstalledbutthelpkfilewasnotfound msgid "This package is installed, but the lpk file was not found. All its components are deactivated. Please fix this." msgstr "" #: lazarusidestrconsts.lispkgsysunitname msgid "%s%sUnit Name: %s%s%s" msgstr "%s%sJméno jednotky: %s%s%s" #: lazarusidestrconsts.lispkgsysunitnotfound msgid "Unit not found: %s%s%s" msgstr "Jednotka nenalezena: %s%s%s" #: lazarusidestrconsts.lispkgsysunitwasremovedfrompackage msgid "Unit %s%s%s was removed from package" msgstr "Jednotka %s%s%s byla odebrána z balíčku" #: lazarusidestrconsts.lispkgthisfileisnotinanyloadedpackage msgid "This file is not in any loaded package." msgstr "" #: lazarusidestrconsts.lispkgunabletoreadpackagefileerror msgid "Unable to read package file %s%s%s.%sError: %s" msgstr "" #: lazarusidestrconsts.lispldexists msgid "Exists" msgstr "Existuje" #: lazarusidestrconsts.lispldglobal msgid "Global" msgstr "Celkový" #: lazarusidestrconsts.lispldonlyexistingfiles msgid "Only existing files" msgstr "Pouze existující soubory" #: lazarusidestrconsts.lispldpackagelinks msgid "Package Links" msgstr "Odakzy balíčku" #: lazarusidestrconsts.lispldshowgloballinks msgid "Show global links" msgstr "Ukázat celkové odkazy" #: lazarusidestrconsts.lispldshowuserlinks msgid "Show user links" msgstr "Ukázat uživatelské odkazy" #: lazarusidestrconsts.lisplduser msgid "User" msgstr "Uživatel" #: lazarusidestrconsts.lispleasecheckthecompilername msgid "Please check the compiler name" msgstr "Zkontrolujte prosím jméno překladače" #: lazarusidestrconsts.lispleasecheckthefpcsourcedirectory msgid "Please check the freepascal source directory" msgstr "" #: lazarusidestrconsts.lispleaseopenaunitbeforerun msgid "Please open a unit before run." msgstr "" #: lazarusidestrconsts.lispleaseselectsomecodetoextractanewproceduremethod msgid "Please select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts.lisplistall msgid "" msgstr "" #: lazarusidestrconsts.lisplistchangefont msgid "Change Font" msgstr "Změnit písmo" #: lazarusidestrconsts.lisplistcopymethodtoclipboard msgid "Copy method name to the clipboard" msgstr "Zkopírovat jméno metody do schránky" #: lazarusidestrconsts.lisplistfilterany msgid "Filter by matching any part of method" msgstr "Filtrovat podle jakékoliv odpovídající části metody" #: lazarusidestrconsts.lisplistfilterstart msgid "Filter by matching with start of method" msgstr "Filtrovat podle začátku metody" #: lazarusidestrconsts.lisplistjumptoselection msgid "Jump To Selection" msgstr "Skoč na výběr" #: lazarusidestrconsts.lisplistnone msgid "" msgstr "<žádný>" #: lazarusidestrconsts.lisplistobjects msgid "&Objects" msgstr "&Objekty" #: lazarusidestrconsts.lisplisttype msgid "Type" msgstr "Typ" #: lazarusidestrconsts.lispochoosepofiledirectory msgid "Choose .po file directory" msgstr "Vyberte adresář .po souborů" #: lazarusidestrconsts.lispodonotsaveanysessioninfo msgid "Do not save any session info" msgstr "Neukládat žádné informace o sezení" #: lazarusidestrconsts.lispointer msgid "Pointer" msgstr "Ukazatel" #: lazarusidestrconsts.lisposaveinideconfigdirectory msgid "Save in IDE config directory" msgstr "Uložit v konfiguračním adresáři IDE" #: lazarusidestrconsts.lisposaveinlpifil msgid "Save in .lpi file" msgstr "Uložit v souboru .lpi" #: lazarusidestrconsts.lisposaveinlpsfileinprojectdirectory msgid "Save in .lps file in project directory" msgstr "Uložit v souboru .lps v adresáři projektu" #: lazarusidestrconsts.lisposavesessioninformationin msgid "Save session information in" msgstr "Uložit informace sezení v" #: lazarusidestrconsts.lisprimaryconfigdirectorywherelazarusstoresitsconfig msgid "primary config directory, where Lazarus stores its config files. Default is " msgstr "hlavní konfigurační složka, kde Lazarus uchovává své konfigurační soubory. Implicitní je " #: lazarusidestrconsts.lisprint msgid "Print" msgstr "Tisknout" #: lazarusidestrconsts.lisprivate msgid "Private" msgstr "Soukromý" #: lazarusidestrconsts.lisprivatemethod msgid "Private Method" msgstr "Soukromá metoda" #: lazarusidestrconsts.lisprobablyyouneedtoinstallsomepackagesforbeforeconti msgid "Probably you need to install some packages for before continuing.%s%sWarning:%sThe project depends on some packages, which contain units with the Register procedure. The Register procedure is normally used to install components in the IDE. But the following units belong to packages which are not yet installed in the IDE. If you try to open a form in the IDE, that uses such components, you will get errors about missing components and the form loading will probably create very unpleasant results.%s%sThis has no impact on opening the project or any of its sources.%s%sIt only means: It is a bad idea to open the forms for designing, before installing the missing packages.%s%s" msgstr "" #: lazarusidestrconsts.lisprocedure msgid "Procedure" msgstr "Procedura" #: lazarusidestrconsts.lisprocedurewithinterface msgid "Procedure with interface" msgstr "Procedurea s rozhranním" #: lazarusidestrconsts.lisproductname msgid "Product Name:" msgstr "Jméno výrobku:" #: lazarusidestrconsts.lisproductversion msgid "Product Version:" msgstr "Verze výrobku:" #: lazarusidestrconsts.lisprogram msgid "Program" msgstr "Program" #: lazarusidestrconsts.lisprogramafreepascalprogramtheprogramfileisautomatic msgid "Program%sA freepascal program. The program file is automatically maintained by lazarus." msgstr "" #: lazarusidestrconsts.lisprogramdetected msgid "Program detected" msgstr "" #: lazarusidestrconsts.lisprogramsourcemusthaveapascalextensionlikepaspporlp msgid "Program source must have a pascal extension like .pas, .pp or .lpr" msgstr "Zdrojový soubor programu musí mít pascalovkou příponu jako .pas, .pp nebo .lpr" #: lazarusidestrconsts.lisprojaddaddfiletoproject msgid "Add file to project:" msgstr "Přidat soubor do projektu:" #: lazarusidestrconsts.lisprojadddependencyalreadyexists msgid "Dependency already exists" msgstr "Závislost již existuje" #: lazarusidestrconsts.lisprojaddeditorfile msgid "Add editor files" msgstr "Přidat editované soubory" #: lazarusidestrconsts.lisprojaddfiles msgid "Add files" msgstr "Přidat soubory" #: lazarusidestrconsts.lisprojaddinvalidminmaxversion msgid "Invalid Min-Max version" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidpackagename msgid "Invalid packagename" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidpascalunitname msgid "Invalid pascal unit name" msgstr "" #: lazarusidestrconsts.lisprojaddinvalidversion msgid "Invalid version" msgstr "Neplatná verze" #: lazarusidestrconsts.lisprojaddmaximumversionoptional msgid "Maximum Version (optional):" msgstr "Maximální verze (nepovinné):" #: lazarusidestrconsts.lisprojaddminimumversionoptional msgid "Minimum Version (optional):" msgstr "Minimální verze (nepovinné):" #: lazarusidestrconsts.lisprojaddnewrequirement msgid "New Requirement" msgstr "Nové požadavky" #: lazarusidestrconsts.lisprojaddpackagename msgid "Package Name:" msgstr "Jméno balíčku:" #: lazarusidestrconsts.lisprojaddpackagenotfound msgid "Package not found" msgstr "Balíček nenalezen" #: lazarusidestrconsts.lisprojaddthedependencywasnotfound msgid "The dependency %s%s%s was not found.%sPlease choose an existing package." msgstr "" #: lazarusidestrconsts.lisprojaddthemaximumversionisinvalid msgid "The Maximum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisprojaddthemaximumversionislowerthantheminimimversion msgid "The Maximum Version is lower than the Minimim Version." msgstr "" #: lazarusidestrconsts.lisprojaddtheminimumversionisinvalid msgid "The Minimum Version %s%s%s is invalid.%sPlease use the format major.minor.release.build%sFor exmaple: 1.0.20.10" msgstr "" #: lazarusidestrconsts.lisprojaddthepackagenameisinvalidplasechooseanexistingpackag msgid "The package name %s%s%s is invalid.%sPlase choose an existing package." msgstr "" #: lazarusidestrconsts.lisprojaddtheprojecthasalreadyadependency msgid "The project has already a dependency for the package %s%s%s." msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheproject msgid "The unit name %s%s%s already exists in the project%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnamealreadyexistsintheselection msgid "The unit name %s%s%s already exists in the selection%swith file: %s%s%s." msgstr "" #: lazarusidestrconsts.lisprojaddtheunitnameisnotavalidpascalidentifier msgid "The unit name %s%s%s is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lisprojaddtoproject msgid "Add to project" msgstr "Přidat do projektu" #: lazarusidestrconsts.lisprojaddunitnamealreadyexists msgid "Unit name already exists" msgstr "Jméno jednotky již existuje" #: lazarusidestrconsts.lisprojectchanged msgid "Project changed" msgstr "Projekt změněn" #: lazarusidestrconsts.lisprojectdirectory msgid "Project directory" msgstr "Složka projektu" #: lazarusidestrconsts.lisprojectfilename msgid "Project filename" msgstr "Jméno souboru projektu" #: lazarusidestrconsts.lisprojectincpath msgid "Project Include Path" msgstr "Cesta začleněných souborů projektu" #: lazarusidestrconsts.lisprojectinfofiledetected msgid "Project info file detected" msgstr "Zjištěn informační soubor projektu" #: lazarusidestrconsts.lisprojectinformation msgid "Project Information" msgstr "Informace projektu" #: lazarusidestrconsts.lisprojectisrunnable msgid "Project is runnable" msgstr "Projekt je spustitelný" #: lazarusidestrconsts.lisprojectmacroproperties msgid "Project macro properties" msgstr "Vlastnosti makra projektu" #: lazarusidestrconsts.lisprojectmacrounitpath msgid "macro ProjectUnitPath" msgstr "" #: lazarusidestrconsts.lisprojectoutdir msgid "Project Output directory (e.g. the ppu directory)" msgstr "" #: lazarusidestrconsts.lisprojectsrcpath msgid "Project Src Path" msgstr "Zdrojová cesta projektu" #: lazarusidestrconsts.lisprojectsuccessfullybuilt msgid "Project %s%s%s successfully built. :)" msgstr "Projekt %s%s%s úspěšně sestaven. :)" #: lazarusidestrconsts.lisprojectunitpath msgid "Project Unit Path" msgstr "Cesta jednotek projektu" #: lazarusidestrconsts.lisprojectwizard msgid "Project Wizard" msgstr "Průvodce projektu" #: lazarusidestrconsts.lisprojinspconfirmdeletingdependency msgid "Confirm deleting dependency" msgstr "" #: lazarusidestrconsts.lisprojinspconfirmremovingfile msgid "Confirm removing file" msgstr "" #: lazarusidestrconsts.lisprojinspdeletedependencyfor msgid "Delete dependency for %s?" msgstr "Odstranit závislost pro %s?" #: lazarusidestrconsts.lisprojinspprojectinspector msgid "Project Inspector - %s" msgstr "" #: lazarusidestrconsts.lisprojinspremovedrequiredpackages msgid "Removed required packages" msgstr "" #: lazarusidestrconsts.lisprojinspremovefilefromproject msgid "Remove file %s from project?" msgstr "Odstranit soubor %s z projektu?" #: lazarusidestrconsts.lisprojmangunabletoreadstatefileofprojecterror msgid "Unable to read state file %s of project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojmangunabletowritestatefileforprojecterror msgid "Unable to write state file for project %s%sError: %s" msgstr "" #: lazarusidestrconsts.lisprojoptsalwaysbuildevenifnothingchanged msgid "Always build (even if nothing changed)" msgstr "Vždy sestavit (i pokud se nic nezmění)" #: lazarusidestrconsts.lisprojoptserror msgid "Error" msgstr "Chyba" #: lazarusidestrconsts.lisprojoptsunabletochangetheautocreateformlist msgid "Unable to change the auto create form list in the program source.%sPlease fix errors first." msgstr "" #: lazarusidestrconsts.lisprojprojectsourcedirectorymark msgid "Project Source Directory Mark" msgstr "" #: lazarusidestrconsts.lispromptforvalue msgid "Prompt for value" msgstr "Dotázat se na hodnotu" #: lazarusidestrconsts.lispropertiesofconditionalcompileroption msgid "Properties of conditional compiler option" msgstr "" #: lazarusidestrconsts.lisprotected msgid "Protected" msgstr "Chráněné" #: lazarusidestrconsts.lisprotectedmethod msgid "Protected Method" msgstr "Chráněné metody" #: lazarusidestrconsts.lispublicmethod msgid "Public Method" msgstr "" #: lazarusidestrconsts.lispublishedmethod msgid "Published Method" msgstr "Zveřejněné metody" #: lazarusidestrconsts.lispublishprojdir msgid "Publish project directory" msgstr "Zveřejni adresář projektu" #: lazarusidestrconsts.lispublprojinvalidexcludefilter msgid "Invalid Exclude filter" msgstr "" #: lazarusidestrconsts.lispublprojinvalidincludefilter msgid "Invalid Include filter" msgstr "" #: lazarusidestrconsts.lisputlrsfilesinoutputdirectory msgid "Save .lrs files in the output directory" msgstr "" #: lazarusidestrconsts.lispvuapascalunitmusthavetheextensionpporpas msgid "A pascal unit must have the extension .pp or .pas" msgstr "Pascalovská jednotka musí mít příponu .pp nebo .pas" #: lazarusidestrconsts.lispvueditvirtualunit msgid "Edit virtual unit" msgstr "Upravit virtuální jednotku" #: lazarusidestrconsts.lispvuthereisalreadyanunitwiththisnamefile msgid "There is already an unit with this name.%sFile: %s" msgstr "" #: lazarusidestrconsts.lispvutheunitnameisnotavalidpascalidentifier msgid "The unitname is not a valid pascal identifier." msgstr "" #: lazarusidestrconsts.lispvutheunitnameisusedwhentheideextendsusesclauses msgid "The unitname is used when the IDE extends uses clauses." msgstr "" #: lazarusidestrconsts.lispvuunitnameandfilenamedonotmatchexampleunit1pasanduni msgid "Unitname and Filename do not match.%sExample: unit1.pas and Unit1" msgstr "Jméno jednotky a souboru si neodpovídají.%sPříklad: unit1.pas a Unit1" #: lazarusidestrconsts.lispwconvertproject msgid "Convert Delphi Project" msgstr "Převést Delphi projekt" #: lazarusidestrconsts.lispwnewproject msgid "New Project" msgstr "Nový projekt" #: lazarusidestrconsts.lispwopenproject msgid "Open Project" msgstr "Otevřít projekt" #: lazarusidestrconsts.lispwopenrecentproject msgid "Open Recent" msgstr "" #: lazarusidestrconsts.lispwrecentprojects msgid "Recent Projects" msgstr "" #: lazarusidestrconsts.lisquitlazarus msgid "Quit Lazarus" msgstr "Ukončit Lazarus" #: lazarusidestrconsts.lisreaderror msgid "Read Error" msgstr "Chyba čtení" #: lazarusidestrconsts.lisrecordstruct msgid "Record/Structure" msgstr "Záznam/Struktura" #: lazarusidestrconsts.lisregisters msgid "Registers" msgstr "" #: lazarusidestrconsts.lisregistersdlgname msgid "Name" msgstr "Jméno" #: lazarusidestrconsts.lisregistersdlgvalue msgid "Value" msgstr "Hodnota" #: lazarusidestrconsts.lisregularexpression msgid "Regular expression" msgstr "Regulární výrazy" #: lazarusidestrconsts.lisrelativepaths msgid "Relative paths" msgstr "Relativní cesty" #: lazarusidestrconsts.lisremove msgid "remove" msgstr "odstranit" #: lazarusidestrconsts.lisremoveallinvalidproperties msgid "Remove all invalid properties" msgstr "Odstranit všechny neplatné vlastnosti" #: lazarusidestrconsts.lisremoveallunits msgid "Remove all units" msgstr "" #: lazarusidestrconsts.lisremovefromproject msgid "Remove from project" msgstr "Odstranit z projektu" #: lazarusidestrconsts.lisremoveselectedunits msgid "Remove selected units" msgstr "" #: lazarusidestrconsts.lisremovethem msgid "Remove them" msgstr "Odstranit je" #: lazarusidestrconsts.lisrenamefile msgid "Rename file?" msgstr "Přejmenovat soubor?" #: lazarusidestrconsts.lisrenamefilefailed msgid "Rename file failed" msgstr "Přejmenování souboru selhalo" #: lazarusidestrconsts.lisrenametolowercase msgid "Rename to lowercase" msgstr "" #: lazarusidestrconsts.lisreopenwithanotherencoding msgid "Reopen with another encoding" msgstr "" #: lazarusidestrconsts.lisrepeatcount msgid "Repeat Count:" msgstr "Počet opakování:" #: lazarusidestrconsts.lisreplacingselectionfailed msgid "Replacing selection failed." msgstr "Nahrazení výběru selhalo." #: lazarusidestrconsts.lisreportingbugurl msgid "http://wiki.lazarus.freepascal.org/How_do_I_create_a_bug_report" msgstr "" #: lazarusidestrconsts.lisresourcefilecomment msgid "This is an automatically generated lazarus resource file" msgstr "Toto je automaticky generovaný zdrojový soubor lazarusu" #: lazarusidestrconsts.lisresourceloaderror msgid "Resource load error" msgstr "" #: lazarusidestrconsts.lisresourcesaveerror msgid "Resource save error" msgstr "" #: lazarusidestrconsts.lisresult msgid "Result :=" msgstr "" #: lazarusidestrconsts.lisresult2 msgid "Result:" msgstr "" #: lazarusidestrconsts.lisrevertfailed msgid "Revert failed" msgstr "Vrácení selhalo" #: lazarusidestrconsts.lisright msgid "Right" msgstr "Vpravo" #: lazarusidestrconsts.lisrightanchoring msgid "Right anchoring" msgstr "" #: lazarusidestrconsts.lisrightborderspacespinedithint msgid "Right borderspace. This value is added to base borderspace and used for the space right to the control." msgstr "" #: lazarusidestrconsts.lisrightsiblingcomboboxhint msgid "This is the sibling control to which the right side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.lisrightsides msgid "Right sides" msgstr "" #: lazarusidestrconsts.lisrightspaceequally msgid "Right space equally" msgstr "" #: lazarusidestrconsts.lisrunparamsfilenotexecutable msgid "File not executable" msgstr "Soubor není spustitelný" #: lazarusidestrconsts.lisrunparamsthehostapplicationisnotexecutable msgid "The host application %s%s%s is not executable." msgstr "" #: lazarusidestrconsts.lisruntofailed msgid "Run-to failed" msgstr "Spustit-po selhalo" #: lazarusidestrconsts.lissamabstractmethodsnotyetoverridden msgid "Abstract methods - not yet overridden" msgstr "Abstraktní metody - doposud nepředefinováno" #: lazarusidestrconsts.lissamabstractmethodsof msgid "Abstract methods of %s" msgstr "Abstraktní metody %s" #: lazarusidestrconsts.lissamcursorisnotinaclassdeclaration msgid "Cursor is not in a class declaration" msgstr "" #: lazarusidestrconsts.lissamideisbusy msgid "IDE is busy" msgstr "IDE je zaneprázdněno" #: lazarusidestrconsts.lissamisanabstractclassithasabstractmethods msgid "%s is an abstract class, it has %s abstract methods." msgstr "%s je abstraktní třída, protože má abstraktní metody %s." #: lazarusidestrconsts.lissamnoabstractmethodsfound msgid "No abstract methods found" msgstr "Nenalezeny abstraktní metody" #: lazarusidestrconsts.lissamoverrideallselected msgid "Override all selected" msgstr "Přepsat celý výběr" #: lazarusidestrconsts.lissamoverridefirstselected msgid "Override first selected" msgstr "Přepsat první vybraný" #: lazarusidestrconsts.lissamselectnone msgid "Select none" msgstr "Vybraz žádný" #: lazarusidestrconsts.lissamthereareabstractmethodstooverrideselectthemethodsf msgid "There are %s abstract methods to override.%sSelect the methods for which stubs should be created:" msgstr "" #: lazarusidestrconsts.lissamtherearenoabstractmethodslefttooverride msgid "There are no abstract methods left to override." msgstr "" #: lazarusidestrconsts.lissamthismethodcannotbeoverriddenbecauseitisdefinedinth msgid "This method can not be overridden because it is defined in the current class" msgstr "" #: lazarusidestrconsts.lissamunabletoshowabstractmethodsofthecurrentclassbecaus msgid "Unable to show abstract methods of the current class, because" msgstr "" #: lazarusidestrconsts.lissave msgid "Save ..." msgstr "Uložit..." #: lazarusidestrconsts.lissaveallmessagestofile msgid "Save all messages to file" msgstr "Uložit všechna hlášení do souboru" #: lazarusidestrconsts.lissaveallmodified msgid "save all modified files" msgstr "Uložit všechny upravené soubory" #: lazarusidestrconsts.lissaveandexitdialog msgid "Save and exit dialog" msgstr "Uložit a ukončovací dialog" #: lazarusidestrconsts.lissaveandrebuildide msgid "Save and rebuild IDE" msgstr "Uložit a znovu sestavit IDE" #: lazarusidestrconsts.lissavechanges msgid "Save changes?" msgstr "Uložit změny?" #: lazarusidestrconsts.lissavechangestoproject msgid "Save changes to project %s?" msgstr "Uložit změny projektu %s?" #: lazarusidestrconsts.lissavecurrenteditorfile msgid "save current editor file" msgstr "uložit aktuální editovaný soubor" #: lazarusidestrconsts.lissaveeditorinfoofnonprojectfiles msgid "Save editor info of non project files" msgstr "" #: lazarusidestrconsts.lissavefileas msgid "Save file as" msgstr "Uložit soubor jako" #: lazarusidestrconsts.lissavefilebeforeclosingform msgid "Save file %s%s%s%sbefore closing form %s%s%s?" msgstr "" #: lazarusidestrconsts.lissaveinfoofclosededitorfiles msgid "Save info of closed editor files" msgstr "" #: lazarusidestrconsts.lissaveprojectlpi msgid "Save Project %s (*.lpi)" msgstr "Uložit projekt %s (*.lpi)" #: lazarusidestrconsts.lissavesettings msgid "Save Settings" msgstr "Uložit nastavení" #: lazarusidestrconsts.lissavespace msgid "Save " msgstr "Uložit" #: lazarusidestrconsts.lisscalingfactor msgid "Scaling factor:" msgstr "" #: lazarusidestrconsts.lissearchfor msgid "Search For " msgstr "" #: lazarusidestrconsts.lissecondaryconfigdirectorywherelazarussearchesfor msgid "secondary config directory, where Lazarus searches for config template files. Default is " msgstr "druhotná konfigurační složka, kde Lazarus hledá šablony konfiguračních souborů. Implicitní je " #: lazarusidestrconsts.lisseemessages msgid "See messages." msgstr "" #: lazarusidestrconsts.lisseeprojectprojectinspector msgid "%sSee Project -> Project Inspector" msgstr "%sPodívejte se na Projekt -> Inspektor projektu" #: lazarusidestrconsts.lisselectahelpitem msgid "Select a help item:" msgstr "" #: lazarusidestrconsts.lisselectanode msgid "Select a node" msgstr "Vyberat uzel" #: lazarusidestrconsts.lisselectdfmfiles msgid "Select Delphi form files (*.dfm)" msgstr "Vybrat soubor formuláře Delphi (*.dfm)" #: lazarusidestrconsts.lisselectedbottomneighbour msgid "(selected bottom neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedleftneighbour msgid "(selected left neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedrightneighbour msgid "(selected right neighbour)" msgstr "" #: lazarusidestrconsts.lisselectedtopneighbour msgid "(selected top neighbour)" msgstr "" #: lazarusidestrconsts.lisselectfile msgid "Select the file" msgstr "Vybrat soubor" #: lazarusidestrconsts.lisselectionexceedsstringconstant msgid "Selection exceeds string constant" msgstr "" #: lazarusidestrconsts.lisselectiontool msgid "Selection tool" msgstr "Nástroj výběru" #: lazarusidestrconsts.lissetdefault msgid "Set default" msgstr "" #: lazarusidestrconsts.lissetvalue msgid "Set value" msgstr "" #: lazarusidestrconsts.lisshort msgid "Short:" msgstr "Krátky:" #: lazarusidestrconsts.lisshow msgid "Show" msgstr "Ukázat" #: lazarusidestrconsts.lisshowgutterinobjectinspector msgid "Show gutter" msgstr "" #: lazarusidestrconsts.lisshowhintsinobjectinspector msgid "Show hints" msgstr "" #: lazarusidestrconsts.lisshowidentifiers msgid "Show identifiers" msgstr "Ukázat identifikátory" #: lazarusidestrconsts.lisshowinfoboxinobjectinspector msgid "Show information box" msgstr "" #: lazarusidestrconsts.lisshowoldtaborder msgid "Show old tab order" msgstr "Ukázat staré pořadí záložek" #: lazarusidestrconsts.lisshowpackages msgid "Show packages" msgstr "Ukázat balíčky" #: lazarusidestrconsts.lisshowspecialcharacters msgid "Show special characters" msgstr "" #: lazarusidestrconsts.lisshowstatusbarinobjectinspector msgid "Show status bar" msgstr "" #: lazarusidestrconsts.lisshowunits msgid "Show units" msgstr "Ukázat jednotky" #: lazarusidestrconsts.lisshowversionandexit msgid "show version and exit" msgstr "" #: lazarusidestrconsts.lisshrinktosmal msgid "Shrink to smallest" msgstr "Zužit na nejmenší" #: lazarusidestrconsts.lissibling msgid "Sibling" msgstr "" #: lazarusidestrconsts.lissimplesyntax msgid "Simple Syntax" msgstr "Jednoduchá syntaxe" #: lazarusidestrconsts.lisskipfileandcontinueloading msgid "Skip file and continue loading" msgstr "Přeskočit soubor a pokračovat v načítání" #: lazarusidestrconsts.lisskiploadinglastproject msgid "Skip loading last project" msgstr "Přeskočit načtení posledního projektu" #: lazarusidestrconsts.lissmallerratherthanfaster msgid "smaller rather than faster" msgstr "menší raději než rychlejší" #: lazarusidestrconsts.lissmatches msgid "Matches" msgstr "Odpovídá" #: lazarusidestrconsts.lissorrynotimplementedyet msgid "Sorry, not implemented yet" msgstr "" #: lazarusidestrconsts.lissorrythistypeisnotyetimplemented msgid "Sorry, this type is not yet implemented" msgstr "Omlouváme se, tento typ ještě nebyl implementován." #: lazarusidestrconsts.lissortselascending msgid "Ascending" msgstr "Vzestupný" #: lazarusidestrconsts.lissortselcancel msgid "Cancel" msgstr "Zrušit" #: lazarusidestrconsts.lissortselcasesensitive msgid "&Case Sensitive" msgstr "&Rozlišovat velikost znaků" #: lazarusidestrconsts.lissortseldescending msgid "Descending" msgstr "Sestupný" #: lazarusidestrconsts.lissortseldomain msgid "Domain" msgstr "Doména" #: lazarusidestrconsts.lissortselignorespace msgid "Ignore Space" msgstr "Ignorovat mezery" #: lazarusidestrconsts.lissortsellines msgid "Lines" msgstr "Řádky" #: lazarusidestrconsts.lissortseloptions msgid "Options" msgstr "Nastavení" #: lazarusidestrconsts.lissortselparagraphs msgid "Paragraphs" msgstr "Odstavce" #: lazarusidestrconsts.lissortselpreview msgid "Preview" msgstr "Náhled" #: lazarusidestrconsts.lissortselsort msgid "Accept" msgstr "Přijmout" #: lazarusidestrconsts.lissortselsortselection msgid "Sort selection" msgstr "Seřadit výběr" #: lazarusidestrconsts.lissortselwords msgid "Words" msgstr "Slova" #: lazarusidestrconsts.lissourceanddestinationarethesame msgid "Source and Destination are the same:%s%s" msgstr "" #: lazarusidestrconsts.lissourcebreakpoint msgid "&Source breakpoint" msgstr "&Zdrojový bod přerušení" #: lazarusidestrconsts.lissourcedirectoryanddestinationdirectoryarethesamema msgid "Source directory %s%s%s%sand destination directory %s%s%s%sare the same.%s%sMaybe you misunderstand this feature.%sIt will clean/recreate the destination directory%sand copies the package/project into it." msgstr "" #: lazarusidestrconsts.lissourcedirectorydoesnotexist msgid "Source directory %s%s%s does not exist." msgstr "" #: lazarusidestrconsts.lissourcemodified msgid "Source modified" msgstr "" #: lazarusidestrconsts.lissourceofpagehaschangedsave msgid "Source of page %s%s%s has changed. Save?" msgstr "" #: lazarusidestrconsts.lissourcepaths msgid "Source paths" msgstr "Zdrojové cesty" #: lazarusidestrconsts.lisspaceequally msgid "Space equally" msgstr "" #: lazarusidestrconsts.lissrcos msgid "Src OS" msgstr "" #: lazarusidestrconsts.lisssearching msgid "Searching" msgstr "Hledání" #: lazarusidestrconsts.lisssearchtext msgid "Search text" msgstr "Hledat text" #: lazarusidestrconsts.lisstartwithanewproject msgid "Start with a new project" msgstr "Začít s novým projektem" #: lazarusidestrconsts.lisstopcurrentdebuggingandrebuildproject msgid "Stop current debugging and rebuild project?" msgstr "Zastavit aktuální ladění a znovu sestavit projekt?" #: lazarusidestrconsts.lisstopdebugging msgid "Stop Debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts.lisstopdebugging2 msgid "Stop debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts.lisstoponexception msgid "Stop on exception" msgstr "Zastavit při vyjímce" #: lazarusidestrconsts.lisstopthedebugging msgid "Stop the debugging?" msgstr "Zastavit ladění?" #: lazarusidestrconsts.lisstreamerror msgid "Stream Error" msgstr "Chyba proudu" #: lazarusidestrconsts.lisstreamingerror msgid "Streaming error" msgstr "Chyba proudového zpracování" #: lazarusidestrconsts.lisstring msgid "String" msgstr "Řetězec" #: lazarusidestrconsts.lisstyle msgid "Style" msgstr "Styl" #: lazarusidestrconsts.lissubprocedure msgid "Sub Procedure" msgstr "" #: lazarusidestrconsts.lissubprocedureonsamelevel msgid "Sub Procedure on same level" msgstr "" #: lazarusidestrconsts.lissuccess msgid "Success" msgstr "Úspěch" #: lazarusidestrconsts.lissvnrevision msgid "SVN Revision: " msgstr "Revize SVN:" #: lazarusidestrconsts.lissvuoinvalidvariablename msgid "Invalid variable name" msgstr "Neplatné jméno proměnné" #: lazarusidestrconsts.lissvuoisnotavalididentifier msgid "%s%s%s is not a valid identifier." msgstr "%s%s%s není platný identifikátor." #: lazarusidestrconsts.lissvuook msgid "Ok" msgstr "Ok" #: lazarusidestrconsts.lissvuooverridesystemvariable msgid "Override system variable" msgstr "" #: lazarusidestrconsts.lissynedit msgid "SynEdit" msgstr "" #: lazarusidestrconsts.lissyntaxmode msgid "Syntax mode" msgstr "Režim sysntaxe" #: lazarusidestrconsts.listab msgid "Tab" msgstr "" #: lazarusidestrconsts.listaborderof msgid "Tab Order of" msgstr "Pořadí záložek" #: lazarusidestrconsts.listargetcpu msgid "Target CPU" msgstr "Cílový CPU" #: lazarusidestrconsts.listargetfilenameofproject msgid "Target filename of project" msgstr "Cílové jméno souboru projektu" #: lazarusidestrconsts.listargetfilenameplusparams msgid "Target filename + params" msgstr "Cílové jméno souboru + parametry" #: lazarusidestrconsts.listargetos msgid "Target OS" msgstr "Cílový OS" #: lazarusidestrconsts.listcompilerinternalerror msgid "Internal compiler error! (%d)" msgstr "Vnitřní chyba překladače! (%d)" #: lazarusidestrconsts.listddinserttodo msgid "Insert ToDo" msgstr "Vložit úkol" #: lazarusidestrconsts.listestdirectory msgid "Test directory" msgstr "Testovací složka" #: lazarusidestrconsts.listheclassisatcontrolandcannotbepastedontoanoncontro msgid "The class %s%s%s is a TControl and can not be pasted onto a non control.%sUnable to paste." msgstr "Třída %s%s%s ke TControl a nemůže být vložena na neovládací prvek.%sNelze vložit." #: lazarusidestrconsts.listhecodetoolsfoundanerror msgid "The codetools found an error:%s%s%s" msgstr "Chyba nalezená codetools:%s%s%s" #: lazarusidestrconsts.listhecommandafterisnotexecutable msgid "The command after %s%s%s is not executable." msgstr "" #: lazarusidestrconsts.listhecommandafterpublishingisinvalid msgid "The command after publishing is invalid:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponentcannotbedeletedbecauseitisnotownedby msgid "The component %s can not be deleted, because it is not owned by %s." msgstr "Komponenta %s nemůže být smazána, protože není vlastněna %s." #: lazarusidestrconsts.listhecomponenteditorofclasshascreatedtheerror msgid "The component editor of class %s%s%s has created the error:%s%s%s%s" msgstr "" #: lazarusidestrconsts.listhecomponenteditorofclassinvokedwithverbhascreated msgid "The component editor of class %s%s%s%sinvoked with verb #%s %s%s%s%shas created the error:%s%s%s%s" msgstr "Třida editoru komponent %s%s%s%svyvolaná slovesem #%s %s%s%s%svytvořila chybu:%s%s%s%s" #: lazarusidestrconsts.listhecomponentisinheritedfromtodeleteaninheritedcomp msgid "The component %s is inherited from %s.%sTo delete an inherited component open the ancestor and delete it there." msgstr "Komponenta %s je zděděná z %s.%sKe smazání zděděné komponenty otevřete předka a smažte ji tam." #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutablecho msgid "The current compiler filename %s%s%s%sis not a valid executable.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "Aktuální soubor překladače %s%s%s%snení platný spustitelný soubor.%sVyberte Ok k výběru výchozího" #: lazarusidestrconsts.listhecurrentcompilerfilenameisnotavalidexecutableplease msgid "The current compiler filename %s%s%s%sis not a valid executable.%sPlease check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentfreepascalsourcedirectorydoesnotlookcorr2 msgid "The current Free Pascal source directory %s%s%s%sdoes not look correct.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sChoose Ok to choose the default %s%s%s.%sOtherwise check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentlazarusdirectorydoesnotlookcorrectwithou2 msgid "The current Lazarus directory %s%s%s%sdoes not look correct.%sWithout it You will not be able to create LCL applications.%sCheck Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhecurrentunitpathforthefileisthepathtothelclunits msgid "The current unit path for the file%s%s%s%s is%s%s%s%s.%s%sThe path to the LCL units %s%s%s is missing.%s%sHint for newbies:%sCreate a lazarus application and put the file into the project directory." msgstr "" #: lazarusidestrconsts.listhedebuggerdoesnotexistsorisnotexecutableseeenviro msgid "The debugger %s%s%s%sdoes not exist or is not executable.%s%sSee Environment -> Debugger Options" msgstr "" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexist msgid "The destination directory%s%s%s%s does not exist." msgstr "" #: lazarusidestrconsts.listhedestinationdirectorydoesnotexistpleasecheckthep msgid "The destination directory %s%s%s does not exist.%sPlease check the project target file name Menu > Project > Project Options." msgstr "" #: lazarusidestrconsts.listhedirectoryisnolongerneededintheunitpathremoveit msgid "The directory %s%s%s is no longer needed in the unit path.%sRemove it?" msgstr "Adresář %s%s%s nadále není potřeba v cestě jednotek.%sOdstranit jej?" #: lazarusidestrconsts.listhedirectoryisnotyetintheunitpathaddit msgid "The directory %s%s%s is not yet in the unit path.%sAdd it?" msgstr "Adresář %s%s%s ještě není v cestě jednotek.%sPřidat jej?" #: lazarusidestrconsts.listhedirectorywasnotfound msgid "The directory %s was not found." msgstr "Adresář %s nebyl nalezen." #: lazarusidestrconsts.listhefile msgid "The file %s%s%s" msgstr "Soubor %s%s%s" #: lazarusidestrconsts.listhefileisasymlinkopeninstead msgid "The file %s%s%s is a symlink.%s%sOpen %s%s%s instead?" msgstr "Soubor %s%s%s je symbolický odkaz.%s%sOtevřít místo něj %s%s%s?" #: lazarusidestrconsts.listhefileisnotadelphiprojectdpr msgid "The file %s%s%s is not a Delphi project (.dpr)" msgstr "Soubor %s%s%s není Delphi projekt." #: lazarusidestrconsts.listhefileisnotadelphiunit msgid "The file %s%s%s is not a Delphi unit." msgstr "Soubor %s%s%s není Delphi jednotka." #: lazarusidestrconsts.listhefileseemstobeaprogramclosecurrentproject msgid "The file %s%s%s%sseems to be a program. Close current project and create a new lazarus project for this program?%s\"No\" will load the file as normal source." msgstr "Soubor %s%s%s%svypadá jako program. Zavřít aktuální projekt a vytvořit nový projekt lazarusu pro tento" #: lazarusidestrconsts.listhefileseemstobetheprogramfileofanexistinglazarusp msgid "The file %s seems to be the program file of an existing lazarus Project." msgstr "Soubor %s vypadá, že je programový soubor existujícícho projektu Lazarusu." #: lazarusidestrconsts.listhefilewasfoundinoneofthesourcedirectoriesofthepac msgid "The file %s%s%s%swas found in one of the source directories of the package %s and looks like a compiled unit. Compiled units must be in the output directory of the package, otherwise other packages can get problems using this package.%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhefilewasnotfounddoyouwanttolocateityourself msgid "The file %s%s%s%swas not found.%sDo you want to locate it yourself ?%s" msgstr "" #: lazarusidestrconsts.listhefilewasnotfoundignorewillgoonloadingtheproject msgid "The file %s%s%s%swas not found.%sIgnore will go on loading the project,%sAbort will stop the loading." msgstr "" #: lazarusidestrconsts.listhefollowingmethodsusedbyarenotinthesourceremoveth msgid "The following methods used by %s are not in the source%s%s%s%s%s%sRemove the dangling references?" msgstr "" #: lazarusidestrconsts.listhefollowingunitswerenotfound1eithertheseunitsaren msgid "The following units were not found:%s%s%s%s1) Either these units are not in the unit path, then you can abort now, fix the unit path and try again.%s2) Or you can ignore the missing units and comment them out." msgstr "Následující jednotky nebyly nalezeny:%s%s%s%s1) Buď nejsou tyto jednotky v cestě jednotek, potom můžete" #: lazarusidestrconsts.listhefreepascalcompilerfilenamewasnotfounditisrecomm msgid "The Free Pascal compiler (filename: %s) was not found.%sIt is recommended that you install fpc." msgstr "" #: lazarusidestrconsts.listhefreepascalsourcedirectorywasnotfoundsomecodefun msgid "The Free Pascal source directory was not found.%sSome code functions will not work.%sIt is recommended that you install it and set the path%sEnvironment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listheidentifierisaunitpleaseusethefilesaveasfunction msgid "The identifier is a unit. Please use the File - Save as function to rename a unit." msgstr "" #: lazarusidestrconsts.listhekeyisalreadyassignedtoremovetheoldassignmentand msgid "The key %s%sis already assigned to %s.%s%sRemove the old assignment and assign the key to the new function%s%s?" msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationbundledoesnotexists msgid "The Application Bundle %s%sneeded for execution does not exist or is not executable.%sDo you want to create one?%s%sSee Project -> Project Options -> Application for settings." msgstr "" #: lazarusidestrconsts.listhelaunchingapplicationdoesnotexistsorisnotexecuta msgid "The launching application %s%s%s%sdoes not exist or is not executable.%s%sSee Run -> Run parameters -> Local" msgstr "" #: lazarusidestrconsts.listhelazarusdirectorywasnotfoundyouwillnotbeabletocr msgid "The Lazarus directory was not found.%sYou will not be able to create LCL applications.%sPlease check Environment -> Environment Options -> Files" msgstr "" #: lazarusidestrconsts.listhelfmlazarusformfilecontainsinvalidpropertiesthis msgid "The LFM (Lazarus form) file contains invalid properties. This means for example it contains some properties/classes, which do not exist in the current LCL. The normal fix is to remove these properties from the lfm and fix the pascal code manually." msgstr "" #: lazarusidestrconsts.listhenameisnotavalidpascalidentifier msgid "The name %s%s%s is not a valid pascal identifier." msgstr "Jméno %s%s%s není platný pascalovský identifikátor." #: lazarusidestrconsts.listhenewunitisnotyetintheunitsearchpathadddirectory msgid "The new unit is not yet in the unit search path.%sAdd directory %s?" msgstr "" #: lazarusidestrconsts.listheoutputdirectoryismissing msgid "The output directory %s%s%s is missing." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheincludesearchpath msgid "The output directory of %s is listed in the include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedincludes msgid "The output directory of %s is listed in the inherited include search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheinheritedunitsear msgid "The output directory of %s is listed in the inherited unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryofislistedintheunitsearchpathof msgid "The output directory of %s is listed in the unit search path of %s." msgstr "" #: lazarusidestrconsts.listheoutputdirectoryshouldbeaseparatedirectoryandnot msgid " The output directory should be a separate directory and not contain any source files." msgstr "Výstupní adresář by měl být samostatný adresář a neměl by obsahovat žádné zdrojové soubory." #: lazarusidestrconsts.listhepackagealreadycontainsaunitwiththisname msgid "The package already contains a unit with this name." msgstr "Balíček již obsahuje jednotku s tímto jménem." #: lazarusidestrconsts.listheprogrammakewasnotfoundthistoolisneededtobuildla msgid "The program %smake%s was not found.%sThis tool is needed to build lazarus.%s" msgstr "" #: lazarusidestrconsts.listheprojectinfofileisequaltotheprojectmainsource msgid "The project info file %s%s%s%sis equal to the project main source file!" msgstr "" #: lazarusidestrconsts.listheprojectmustbesavedbeforebuildingifyousetthetest msgid "The project must be saved before building%sIf you set the Test Directory in the environment options,%syou can create new projects and build them at once.%sSave project?" msgstr "" #: lazarusidestrconsts.listheprojectusestargetosandcputhesystemppuforthistar msgid "The project uses target OS=%s and CPU=%s.%sThe system.ppu for this target was not found in the FPC binary directories. %sMake sure fpc is installed correctly for this target and the fpc.cfg contains the right directories." msgstr "" #: lazarusidestrconsts.listhereareotherfilesinthedirectorywiththesamename msgid "There are other files in the directory with the same name,%swhich only differ in case:%s%s%sDelete them?" msgstr "V adresáři jsou další soubory se stejným jménem, %skteré se liší pouze ve velikosti písmen:%s%s%sSmazat je?" #: lazarusidestrconsts.listhereisafilewiththesamenameandasimilarextension msgid "There is a file with the same name and a similar extension ond disk%sFile: %s%sAmbiguous File: %s%s%sDelete ambiguous file?" msgstr "" #: lazarusidestrconsts.listhereisalreadyabuildmodewiththename msgid "There is already a build mode with the name %s%s%s." msgstr "" #: lazarusidestrconsts.listhereisalreadyaformwiththename msgid "There is already a form with the name %s%s%s" msgstr "" #: lazarusidestrconsts.listhereisalreadyaunitwiththenamepascalidentifiersmus msgid "There is already a unit with the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts.listhereisaunitwiththenameintheprojectpleasechoose msgid "There is a unit with the name %s%s%s in the project.%sPlease choose a different name" msgstr "" #: lazarusidestrconsts.listheresourceclassdescendsfromprobablythisisatypofor msgid "The resource class %s%s%s descends from %s%s%s. Probably this is a typo for TForm." msgstr "" #: lazarusidestrconsts.listherewasanerrorduringwritingtheselectedcomponent msgid "There was an error during writing the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts.listherewasanerrorwhileconvertingthebinarystreamofthe msgid "There was an error while converting the binary stream of the selected component %s:%s:%s%s" msgstr "" #: lazarusidestrconsts.listherewasanerrorwhilecopyingthecomponentstreamtocli msgid "There was an error while copying the component stream to clipboard:%s%s" msgstr "" #: lazarusidestrconsts.listherootcomponentcannotbedeleted msgid "The root component can not be deleted." msgstr "Kořenový komponentu nelze smazat." #: lazarusidestrconsts.listhetestdirectorycouldnotbefoundseeenvironmentopt msgid "The Test Directory could not be found:%s%s%s%s%s(see environment options)" msgstr "" #: lazarusidestrconsts.listheunitalreadyexistsignorewillforcetherenaming msgid "The unit %s%s%s already exists.%sIgnore will force the renaming,%sCancel will cancel the saving of this source and%sAbort will abort the whole saving." msgstr "" #: lazarusidestrconsts.listheunitexiststwiceintheunitpathofthe msgid "The unit %s exists twice in the unit path of the %s:" msgstr "" #: lazarusidestrconsts.listheunitisnotlowercasethefreepascalcompiler msgid "The unit filename %s%s%s is not lowercase.%sThe FreePascal compiler does not search for all cases. It is recommended to use lowercase filename.%s%sRename file lowercase?" msgstr "" #: lazarusidestrconsts.listheunitisusedbyotherfilesupdatereferencesautomatic msgid "The unit %s is used by other files.%sUpdate references automatically?" msgstr "" #: lazarusidestrconsts.listheunititselfhasalreadythenamepascalidentifiersmus msgid "The unit itself has already the name %s%s%s. Pascal identifiers must be unique." msgstr "" #: lazarusidestrconsts.listheunitsearchpathofcontainsthesourcedirectoryofpac msgid "The unit search path of %s%s%s contains the source directory %s%s%s of package %s" msgstr "" #: lazarusidestrconsts.listheworkingdirectorydoesnotexistpleasechecktheworki msgid "The working directory %s%s%s does not exist.%sPlease check the working directory in Menu > Run > Run parameters." msgstr "" #: lazarusidestrconsts.listhishelpmessage msgid "this help message" msgstr "tato zpráva nápovědy" #: lazarusidestrconsts.listhislookslikeapascalfileitisrecommendedtouselowerc msgid "This looks like a pascal file.%sIt is recommended to use lower case filenames, to avoid various problems on some filesystems and different compilers.%sRename it to lowercase?" msgstr "" #: lazarusidestrconsts.listhisstatementcannotbeextractedpleaseselectsomecode msgid "This statement can not be extracted.%sPlease select some code to extract a new procedure/method." msgstr "" #: lazarusidestrconsts.listhiswillhappencontinue msgid "This will happen:%s%s%sContinue?" msgstr "Toto se stane:%s%s%sPokračovat?" #: lazarusidestrconsts.listitle msgid "&Title" msgstr "" #: lazarusidestrconsts.listitleleaveemptyfordefault msgid "Title (leave empty for default)" msgstr "Název (nechejte prázdné pro výchozí)" #: lazarusidestrconsts.listmfunctionappendpathdelimiter msgid "Function: append path delimiter" msgstr "" #: lazarusidestrconsts.listmfunctionchomppathdelimiter msgid "Function: chomp path delimiter" msgstr "" #: lazarusidestrconsts.listmfunctionextractfileextension msgid "Function: extract file extension" msgstr "" #: lazarusidestrconsts.listmfunctionextractfilenameextension msgid "Function: extract file name+extension" msgstr "" #: lazarusidestrconsts.listmfunctionextractfilenameonly msgid "Function: extract file name only" msgstr "" #: lazarusidestrconsts.listmfunctionextractfilepath msgid "Function: extract file path" msgstr "" #: lazarusidestrconsts.listmunknownmacro msgid "(unknown macro: %s)" msgstr "(neznámé makro: %s)" #: lazarusidestrconsts.listodogoto msgid "Goto" msgstr "Přejít" #: lazarusidestrconsts.listodoldescription msgid "Description" msgstr "Popis" #: lazarusidestrconsts.listodoldone msgid "Done" msgstr "Hotovo" #: lazarusidestrconsts.listodolfile msgid "Module" msgstr "Modul" #: lazarusidestrconsts.listodolistcaption msgid "ToDo List" msgstr "Seznam úkolů" #: lazarusidestrconsts.listodolistgotoline msgid "Goto selected source line" msgstr "Přejít na vybraný zdrojový řádek" #: lazarusidestrconsts.listodolistoptions msgid "ToDo options..." msgstr "Volby seznamu úkolů..." #: lazarusidestrconsts.listodolistprintlist msgid "Print todo items" msgstr "Tisk položek úkolovníku" #: lazarusidestrconsts.listodolistrefresh msgid "Refresh todo items" msgstr "Obnovit seznam úkolů" #: lazarusidestrconsts.listodolline msgid "Line" msgstr "Řádek" #: lazarusidestrconsts.listodolowner msgid "Owner" msgstr "Vlastník" #: lazarusidestrconsts.listodolpriority msgid "Priority" msgstr "Priorita" #: lazarusidestrconsts.listofpcpath msgid "Path:" msgstr "Cesta:" #: lazarusidestrconsts.listoggleshowingfilenameswithfullpathorwithrelativepa msgid "Toggle showing filenames with full path or with relative path" msgstr "Přepnout zobrazení názvů souborů s plnou cestou nebo s relativní cestou" #: lazarusidestrconsts.listop msgid "Top" msgstr "Nahoře" #: lazarusidestrconsts.listopanchoring msgid "Top anchoring" msgstr "Přichycení nahoru" #: lazarusidestrconsts.listopborderspacespinedithint msgid "Top borderspace. This value is added to base borderspace and used for the space above the control." msgstr "Horní okrajový prostor. Tato hodnota je přidána jako základ okrajového prostoru a použta pro prostor nad prvkem." #: lazarusidestrconsts.listops msgid "Tops" msgstr "" #: lazarusidestrconsts.listopsiblingcomboboxhint msgid "This is the sibling control to which the top side is anchored. Leave empty for parent." msgstr "" #: lazarusidestrconsts.listopspaceequally msgid "Top space equally" msgstr "" #: lazarusidestrconsts.listtodolcategory msgid "Category" msgstr "Skupina" #: lazarusidestrconsts.listurbopascal msgid "Turbo Pascal" msgstr "Turbo Pascal" #: lazarusidestrconsts.lisuedonotsho msgid "Do not show this message again." msgstr "Neukazovat znova tuto zprávu." #: lazarusidestrconsts.lisueerrorinregularexpression msgid "Error in regular expression" msgstr "Chyba v regulárním výrazu" #: lazarusidestrconsts.lisuefontwith msgid "Font without UTF-8" msgstr "Písmo bez UTF-8" #: lazarusidestrconsts.lisuegotoline msgid "Goto line :" msgstr "" #: lazarusidestrconsts.lisuenotfound msgid "Not found" msgstr "Nenalezeno" #: lazarusidestrconsts.lisuereadonly msgid "%s/ReadOnly" msgstr "%s/Pouze pro čtení" #: lazarusidestrconsts.lisuereplacethisoccurrenceofwith msgid "Replace this occurrence of %s%s%s%s with %s%s%s?" msgstr "" #: lazarusidestrconsts.lisuesearching msgid "Searching: %s" msgstr "Hledání: %s" #: lazarusidestrconsts.lisuesearchstringnotfound msgid "Search string '%s' not found!" msgstr "Hledaný řetězec '%s' nenalezen!" #: lazarusidestrconsts.lisuethecurre msgid "The current editor font does not support UTF-8, but your system seems to use it.%sThat means non ASCII characters will probably be shown incorrect.%sYou can select another font in the editor options." msgstr "Aktuální písmo editoru nepodporuje UTF-8, ale váš sytém vypadá, že ho používá.%sTo znamená, že ne-ASCII" #: lazarusidestrconsts.lisuiclearincludedbyreference msgid "Clear include cache" msgstr "Smazat vyrovnávací paměť pro include" #: lazarusidestrconsts.lisuidbytes msgid "%s bytes" msgstr "%s bajtů" #: lazarusidestrconsts.lisuidclear msgid "Clear" msgstr "Smazat" #: lazarusidestrconsts.lisuidincludedby msgid "Included by:" msgstr "Zahrnut tímto:" #: lazarusidestrconsts.lisuidinproject msgid "in Project:" msgstr "v projektu:" #: lazarusidestrconsts.lisuidlines msgid "Lines:" msgstr "Řádky:" #: lazarusidestrconsts.lisuidname msgid "Name:" msgstr "Jméno:" #: lazarusidestrconsts.lisuidno msgid "no" msgstr "ne" #: lazarusidestrconsts.lisuidok msgid "Ok" msgstr "Ok" #: lazarusidestrconsts.lisuidpathsreadonly msgid "Paths (Read Only)" msgstr "Cesty (pouze ke čtení)" #: lazarusidestrconsts.lisuidsize msgid "Size:" msgstr "Velikost:" #: lazarusidestrconsts.lisuidsrc msgid "Src" msgstr "Zdroj" #: lazarusidestrconsts.lisuidtype msgid "Type:" msgstr "Typ:" #: lazarusidestrconsts.lisuidunit msgid "Unit" msgstr "Jednotka" #: lazarusidestrconsts.lisuidyes msgid "yes" msgstr "ano" #: lazarusidestrconsts.lisuishowcodetoolsvalues msgid "Show CodeTools Values" msgstr "Ukázat hodnoty CodeTools" #: lazarusidestrconsts.lisunableconvertbinarystreamtotext msgid "Unable convert binary stream to text" msgstr "Nelze převést binární proud na text" #: lazarusidestrconsts.lisunablecopycomponentstoclipboard msgid "Unable copy components to clipboard" msgstr "Nelze zkopírovat komponenty do schránky" #: lazarusidestrconsts.lisunabletoaddresourceheadercommenttoresourcefile msgid "Unable to add resource header comment to resource file %s%s%s%s.%sProbably a syntax error." msgstr "Nelze přidat zdrojovou hlavičku do souboru zdrojů %s%s%s%s.%sNejspíše chyba syntaxe." #: lazarusidestrconsts.lisunabletoaddresourcetformdatatoresourcefileprobably msgid "Unable to add resource T%s:FORMDATA to resource file %s%s%s%s.%sProbably a syntax error." msgstr "" #: lazarusidestrconsts.lisunabletoaddtoprojectbecausethereisalreadyaunitwith msgid "Unable to add %s to project, because there is already a unit with the same name in the Project." msgstr "" #: lazarusidestrconsts.lisunabletobackupfileto msgid "Unable to backup file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts.lisunabletochangeclassofto msgid "%s%sUnable to change class of %s to %s" msgstr "%s%sNelze změnit jméno třídy %s na %s" #: lazarusidestrconsts.lisunabletocleanupdestinationdirectory msgid "Unable to clean up destination directory" msgstr "" #: lazarusidestrconsts.lisunabletocleanuppleasecheckpermissions msgid "Unable to clean up %s%s%s.%sPlease check permissions." msgstr "" #: lazarusidestrconsts.lisunabletoconvertcomponenttextintobinaryformat msgid "Unable to convert component text into binary format:%s%s" msgstr "" #: lazarusidestrconsts.lisunabletoconvertfileerror msgid "Unable to convert file %s%s%s%sError: %s" msgstr "Nelze převést soubor %s%s%s%sChyba: %s" #: lazarusidestrconsts.lisunabletoconvertlfmtolrsandwritelrsfile msgid "Unable to convert lfm to lrs and write lrs file." msgstr "Nelze převést soubor lfm na lrs a zapsat lrs." #: lazarusidestrconsts.lisunabletoconverttextformdataoffileintobinarystream msgid "Unable to convert text form data of file %s%s%s%s%sinto binary stream. (%s)" msgstr "" #: lazarusidestrconsts.lisunabletocopyfile msgid "Unable to copy file" msgstr "Soubor nelze zkopírovat" #: lazarusidestrconsts.lisunabletocopyfileto msgid "Unable to copy file %s%s%s%sto %s%s%s" msgstr "Nelze zkopírovat soubor %s%s%s%sna %s%s%s" #: lazarusidestrconsts.lisunabletocopyfileto2 msgid "Unable to copy file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletocreatebackupdirectory msgid "Unable to create backup directory %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletocreatedirectory msgid "Unable to create directory %s%s%s." msgstr "Nelze vytvořit adresář %s%s%s." #: lazarusidestrconsts.lisunabletocreatedirectory2 msgid "Unable to create directory %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocreatefile msgid "Unable to create file" msgstr "" #: lazarusidestrconsts.lisunabletocreatefile2 msgid "Unable to create file %s%s%s" msgstr "Nelze vytvořit soubor %s%s%s" #: lazarusidestrconsts.lisunabletocreatefile3 msgid "Unable to create file%s%s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocreatefilename msgid "Unable to create file %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletocreatelinkwithtarget msgid "Unable to create link %s%s%s with target %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletocreatenewmethodpleasefixtheerrorshownin msgid "Unable to create new method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts.lisunabletocreatetemporarylfmbuffer msgid "Unable to create temporary lfm buffer." msgstr "" #: lazarusidestrconsts.lisunabletodeleteambiguousfile msgid "Unable to delete ambiguous file %s%s%s" msgstr "" #: lazarusidestrconsts.lisunabletofindaresourcestringsectioninthisoranyofthe msgid "Unable to find a ResourceString section in this or any of the used units." msgstr "" #: lazarusidestrconsts.lisunabletofindavalidclassnamein msgid "Unable to find a valid classname in %s%s%s" msgstr "Nelze najít platné jméno třídy v %s%s%s" #: lazarusidestrconsts.lisunabletofindfile msgid "Unable to find file %s%s%s." msgstr "Nelze nalézt soubor %s%s%s." #: lazarusidestrconsts.lisunabletofindfilechecksearchpathinprojectcompileroption msgid "Unable to find file %s%s%s.%sIf it belongs to your project, check search path in%sProject->Compiler Options...->Search Paths->Other Unit Files. If this file belongs to a package, check the appropriate package compiler options. If this file belongs to lazarus, make sure compiling clean. If the file belongs to FPC then check fpc.cfg. If unsure, check Project -> CompilerOptions ... -> Test" msgstr "" #: lazarusidestrconsts.lisunabletofindinlfmstream msgid "Unable to find %s in LFM Stream." msgstr "" #: lazarusidestrconsts.lisunabletofindmethodpleasefixtheerrorshowninthemessage msgid "Unable to find method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts.lisunabletofindtheunitofcomponentclass msgid "Unable to find the unit of component class %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletogathereditorchanges msgid "Unable to gather editor changes." msgstr "Nelze získat změny v editoru." #: lazarusidestrconsts.lisunabletogetsourcefordesigner msgid "Unable to get source for designer." msgstr "Nelze získat zdroj pro návrhář." #: lazarusidestrconsts.lisunabletoloadoldresourcefiletheresourcefileis msgid "Unable to load old resource file.%sThe resource file is the first include file in the%sinitialization section.%sFor example {$I %s.lrs}.%sProbably a syntax error." msgstr "Nelze načíst starý soubor zdrojů.%sSoubor zdrojů je první vkládaný soubor v inicializační části %s.Na příklad {$I %s.lrs}.%sPravděpodobně chyba syntaxe." #: lazarusidestrconsts.lisunabletoloadpackage msgid "Unable to load package %s%s%s" msgstr "Nelze přečíst balíček %s%s%" #: lazarusidestrconsts.lisunabletoloadthecomponentclassbecauseitdependsonits msgid "Unable to load the component class %s%s%s, because it depends on itself." msgstr "Nelze načíst třídu komponenty %s%s%s, protože závisí na sobě samé." #: lazarusidestrconsts.lisunabletoopenancestorcomponent msgid "Unable to open ancestor component" msgstr "" #: lazarusidestrconsts.lisunabletoopendesignertheclassdoesnotdescendfromades msgid "Unable to open designer.%sThe class %s does not descend from a designable class like TForm or TDataModule." msgstr "Nelze otevřít návrhář.%sTřída %s není potomek návrhářské třídy jako TForm nebo TDataModule." #: lazarusidestrconsts.lisunabletoread msgid "Unable to read %s" msgstr "Nelze přečíst %s" #: lazarusidestrconsts.lisunabletoreadfile msgid "Unable to read file" msgstr "Nelze přečíst soubor" #: lazarusidestrconsts.lisunabletoreadfile2 msgid "Unable to read file %s%s%s!" msgstr "Nelze přečíst soubor %s%s%s!" #: lazarusidestrconsts.lisunabletoreadfileerror msgid "Unable to read file %s%s%s%sError: %s" msgstr "Nelze číst soubor %s%s%s%sChyba: %s" #: lazarusidestrconsts.lisunabletoreadfilename msgid "Unable to read file %s%s%s." msgstr "Nelze přečíst soubor %s%s%s." #: lazarusidestrconsts.lisunabletoremoveoldbackupfile msgid "Unable to remove old backup file %s%s%s!" msgstr "Nelze odstranit starý záložní soubor %s%s%s!" #: lazarusidestrconsts.lisunabletorenameambiguousfileto msgid "Unable to rename ambiguous file %s%s%s%sto %s%s%s" msgstr "Nelze přejmenovat nejednoznačný soubor %s%s%s%sna %s%s%s" #: lazarusidestrconsts.lisunabletorenamefile msgid "Unable to rename file" msgstr "Soubor nelze přejmenovat" #: lazarusidestrconsts.lisunabletorenamefileto msgid "Unable to rename file %s%s%s to %s%s%s!" msgstr "" #: lazarusidestrconsts.lisunabletorenamefileto2 msgid "Unable to rename file %s%s%s%sto %s%s%s." msgstr "" #: lazarusidestrconsts.lisunabletorenameforminsource msgid "Unable to rename form in source." msgstr "Nelze přejmenovat formulář ve zdrojovém souboru." #: lazarusidestrconsts.lisunabletorenamemethodpleasefixtheerrorshowninthemessag msgid "Unable to rename method. Please fix the error shown in the message window." msgstr "Nelze přejmenovat metodu. Prosím vyřešte chybu ukázanou v okně zpráv." #: lazarusidestrconsts.lisunabletorenamevariableinsource msgid "Unable to rename variable in source." msgstr "Nelze přejmenovat proměnnou ve zdrojovém souboru." #: lazarusidestrconsts.lisunabletorun msgid "Unable to run" msgstr "Nelze spustit" #: lazarusidestrconsts.lisunabletosavefile msgid "Unable to save file %s%s%s" msgstr "Soubor %s%s%s nelze uložit" #: lazarusidestrconsts.lisunabletosetanchorsidecontrol msgid "Unable to set AnchorSide Control" msgstr "Nelze nastavit AnchorSide Control" #: lazarusidestrconsts.lisunabletoshowmethodpleasefixtheerrorshowninthemessage msgid "Unable to show method. Please fix the error shown in the message window." msgstr "" #: lazarusidestrconsts.lisunabletostreamselectedcomponents msgid "Unable to stream selected components" msgstr "" #: lazarusidestrconsts.lisunabletostreamselectedcomponents2 msgid "Unable to stream selected components." msgstr "" #: lazarusidestrconsts.lisunabletostreamt msgid "Unable to stream %s:T%s." msgstr "" #: lazarusidestrconsts.lisunabletotransformbinarycomponentstreamoftintotext msgid "Unable to transform binary component stream of %s:T%s into text." msgstr "Nelze převést komponentu v binárním proudu %s:T%s na text." #: lazarusidestrconsts.lisunabletoupdatecreateformstatementinprojectsource msgid "Unable to update CreateForm statement in project source" msgstr "Nelze zaktualizovat příkaz CreateForm v zdrojovém souboru projektu" #: lazarusidestrconsts.lisunabletoupdatethebinaryresourcefilefromfilethetext msgid "Unable to update the binary resource file%s%s%sfrom file the text resource file%s%s%s%sProbably the text file is corrupt." msgstr "Nelze aktualizovat binární zdrojový soubor%s%s%sz textového zdrojového souboru%s%s%s%sTextový soubor" #: lazarusidestrconsts.lisunabletowrite msgid "Unable to write %s%s%s%s%s." msgstr "Nelze zapisovat %s%s%s%s%s." #: lazarusidestrconsts.lisunabletowrite2 msgid "Unable to write %s%s%s" msgstr "Nelze zapisovat do %s%s%s" #: lazarusidestrconsts.lisunabletowritefile msgid "Unable to write file" msgstr "Nelze zapsat soubor" #: lazarusidestrconsts.lisunabletowritefile2 msgid "Unable to write file %s%s%s" msgstr "Nelze zapsat soubor %s%s%s" #: lazarusidestrconsts.lisunabletowritefileerror msgid "Unable to write file %s%s%s%sError: %s" msgstr "Nelze zapisovat do souboru %s%s%s%sChyba: %s" #: lazarusidestrconsts.lisunabletowritefilename msgid "Unable to write file %s%s%s." msgstr "Nelze zapsat soubor %s%s%s." #: lazarusidestrconsts.lisunabletowritetofile msgid "Unable to write to file %s%s%s!" msgstr "Nelze zapsat do souboru %s%s%s!" #: lazarusidestrconsts.lisunabletowritetofile2 msgid "Unable to write to file %s%s%s" msgstr "Nelze zapsat do souboru %s%s%s" #: lazarusidestrconsts.lisunabletowritexmlstreamtoerror msgid "Unable to write xml stream to %s%sError: %s" msgstr "Nelze zapsat xml proud do %s%sChyba: %s" #: lazarusidestrconsts.lisuninstallselection msgid "Uninstall selection" msgstr "Odinstalovat vybrané?" #: lazarusidestrconsts.lisunithaschangedsave msgid "Unit %s%s%s has changed. Save?" msgstr "Jednotka %s%s%s byla změněna. Uložit?" #: lazarusidestrconsts.lisunitidentifierexists msgid "Unit identifier exists" msgstr "Identifikátor jednotky již existuje" #: lazarusidestrconsts.lisunitinpackage msgid "%s unit %s in package %s%s" msgstr "%s jednotka %s v balíčku %s%s" #: lazarusidestrconsts.lisunitlfmfile msgid "Unit: %s%sLFM file: %s" msgstr "Jednotka: %s%ssoubor LFM: %s" #: lazarusidestrconsts.lisunitnamealreadyexistscap msgid "Unitname already in project" msgstr "Jméno jednotky je už v projektu" #: lazarusidestrconsts.lisunitnamebeginswith msgid "Unit name begins with ..." msgstr "Jméno jednotky začíná s..." #: lazarusidestrconsts.lisunitnamecontains msgid "Unit name contains ..." msgstr "Jméno jednotky obsahuje..." #: lazarusidestrconsts.lisunitnotfound msgid "Unit not found" msgstr "Jednotka nenalezena" #: lazarusidestrconsts.lisunitoutputdirectory msgid "Unit Output directory" msgstr "Výstupní adresář jednotky" #: lazarusidestrconsts.lisunitpath msgid "unit path" msgstr "cesta jednotky" #: lazarusidestrconsts.lisunitpaths msgid "Unit paths" msgstr "Cesty jednotky" #: lazarusidestrconsts.lisunitsnotfound2 msgid "Units not found" msgstr "Jednotka nenalezena" #: lazarusidestrconsts.lisunusedunits msgid "Unused units" msgstr "" #: lazarusidestrconsts.lisupdatepreview msgid "Update preview" msgstr "Aktualizovat náhled" #: lazarusidestrconsts.lisupdatereferences msgid "Update references?" msgstr "" #: lazarusidestrconsts.lisusagemessagehoption msgid "Usage message (-h option)" msgstr "" #: lazarusidestrconsts.lisuseexcludefilter msgid "Use Exclude Filter" msgstr "Použít filtr vyřazení" #: lazarusidestrconsts.lisuseincludefilter msgid "Use Include Filter" msgstr "Použít filtr zahrnutí" #: lazarusidestrconsts.lisuselaunchingapplicationgroupbox msgid "Launching application" msgstr "Spouštím aplikaci" #: lazarusidestrconsts.lisusershomedirectory msgid "User's home directory" msgstr "Uživatelský domovský adresář" #: lazarusidestrconsts.lisutf8withbom msgid "UTF-8 with BOM" msgstr "" #: lazarusidestrconsts.lisvalue msgid "Value:" msgstr "" #: lazarusidestrconsts.lisvalue2 msgid "Value%s" msgstr "" #: lazarusidestrconsts.lisvalues msgid "Values" msgstr "" #: lazarusidestrconsts.lisverifymethodcalls msgid "Verify method calls" msgstr "Ověřeit volání metod" #: lazarusidestrconsts.lisversion msgid "Version" msgstr "Verze" #: lazarusidestrconsts.lisvertical msgid "Vertical" msgstr "Svislý" #: lazarusidestrconsts.lisvertoclipboard msgid "Copy version information to clipboard" msgstr "Zkopírovat informace o verzi do schránky" #: lazarusidestrconsts.lisviewprojectunits msgid "View Project Units" msgstr "Zobrazit jednotky projektu" #: lazarusidestrconsts.lisviewsourcelfm msgid "View Source (.lfm)" msgstr "Zobrazit zdroj (.lfm)" #: lazarusidestrconsts.lisvsrforwardsearch msgid "Forward Search" msgstr "Dopředné hledání" #: lazarusidestrconsts.lisvsrresetresultlist msgid "Reset Result List" msgstr "Resetovat seznam výsledků" #: lazarusidestrconsts.liswarningambiguousfilefoundsourcefileis msgid "Warning: ambiguous file found: %s%s%s. Source file is: %s%s%s" msgstr "Varování: nejednoznačný soubor nalezen: %s%s%s. Zdrojový soubor je: %s%s%" #: lazarusidestrconsts.liswatchpropert msgid "Watch Properties" msgstr "Vlastnosti sledování" #: lazarusidestrconsts.liswhenaunitisrenamedupdatereferences msgid "When a unit is renamed, update references ..." msgstr "" #: lazarusidestrconsts.liswithrequiredpackages msgid "With required packages" msgstr "S požadovanými balíčky" #: lazarusidestrconsts.liswladd msgid "&Add" msgstr "&Přidat" #: lazarusidestrconsts.liswldelete msgid "&Delete" msgstr "&Smazat" #: lazarusidestrconsts.liswldeleteall msgid "De&lete All" msgstr "Sma&zat vše" #: lazarusidestrconsts.liswldisableall msgid "D&isable All" msgstr "Z&akázat vše" #: lazarusidestrconsts.liswlenableall msgid "E&nable All" msgstr "&Povolit vše" #: lazarusidestrconsts.liswlenabled msgid "&Enabled" msgstr "&Povolený" #: lazarusidestrconsts.liswlexpression msgid "Expression" msgstr "Výraz" #: lazarusidestrconsts.liswlproperties msgid "&Properties" msgstr "&Vlastnosti" #: lazarusidestrconsts.liswlwatchlist msgid "Watch list" msgstr "Seznam sledování" #: lazarusidestrconsts.liswordatcursorincurrenteditor msgid "Word at cursor in current editor" msgstr "Slovo na pozici kurzoru v aktuálním editoru" #: lazarusidestrconsts.lisworkingdirectoryforbuilding msgid "Working directory for building" msgstr "Pracovní složka pro sestavení" #: lazarusidestrconsts.lisworkingdirectoryforrun msgid "Working directory for run" msgstr "Pracovní složka pro spuštění" #: lazarusidestrconsts.liswriteerror msgid "Write Error" msgstr "Chyba zápisu" #: lazarusidestrconsts.liswriteerrorfile msgid "Write error: %s%sFile: %s%s%s" msgstr "Chyba zápisu: %s%sSoubor: %s%s%s" #: lazarusidestrconsts.lisxmlerror msgid "XML Error" msgstr "Chyba XML" #: lazarusidestrconsts.lisxmlfiles msgid "XML files" msgstr "XML soubory" #: lazarusidestrconsts.lisxmlparsererrorinfileerror msgid "XML parser error in file %s%sError: %s" msgstr "Chyba XML analyzátoru v souboru %s%sChyba: %s" #: lazarusidestrconsts.lisyoucannotbuildlazaruswhiledebuggingorcompiling msgid "You can not build lazarus while debugging or compiling." msgstr "Nemůžete sestavit lazarus v průběhu ladění nebo překládání." #: lazarusidestrconsts.locwndsrceditor msgid "Source Editor" msgstr "" #: lazarusidestrconsts.podaddpackageunittousessection msgid "Add package unit to uses section" msgstr "Přidat jednotku balíčku do sekce uses" #: lazarusidestrconsts.rsaddinverse msgid "Add Inverse" msgstr "Přidat inverzi" #: lazarusidestrconsts.rsadditionalinfo msgid "Additional info" msgstr "Doplňující informace" #: lazarusidestrconsts.rsautomaticallyincreasebuildnumber msgid "Automatically increase build number" msgstr "Automaticky zvyšovat číslo sestavení" #: lazarusidestrconsts.rsavailablescanners msgid "Available scanners" msgstr "" #: lazarusidestrconsts.rsbuild msgid "Build:" msgstr "Sestavení:" #: lazarusidestrconsts.rscharacterset msgid "Character set:" msgstr "Mapa znaků:" #: lazarusidestrconsts.rsclosecurrentpage msgid "Close current page" msgstr "" #: lazarusidestrconsts.rsconditionaldefines msgid "Conditional defines" msgstr "Podmíněné definice" #: lazarusidestrconsts.rscopyright msgid "Copyright:" msgstr "Kopírovací práva:" #: lazarusidestrconsts.rscreatenewdefine msgid "Create new define" msgstr "Vytvořit novou definici" #: lazarusidestrconsts.rscreatingdirfailed msgid "Creating directory \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinkfailed msgid "Creating symbolic link \"%s\" failed!" msgstr "" #: lazarusidestrconsts.rscreatingsymlinknotsupported msgid "Creating symbolic link is not supported on this platform!" msgstr "" #: lazarusidestrconsts.rsenablei18n msgid "Enable i18n" msgstr "Povolit i18n" #: lazarusidestrconsts.rsenteroneormorephrasesthatyouwanttosearchorfilterin msgid "Enter one or more phrases that you want to Search or Filter in the list, separated by space, or comma" msgstr "" #: lazarusidestrconsts.rsfilterthelistwiththecurrentfilterexpression msgid "Filter the list with the current filter expression" msgstr "" #: lazarusidestrconsts.rsformdatafiledfm msgid "Form data file (*.dfm)|*.dfm" msgstr "Datový soubor formuláře (*.dfm)|*.dfm" #: lazarusidestrconsts.rsfoundbutnotlistedhere msgid "Found, but not listed here: " msgstr "" #: lazarusidestrconsts.rsgotothenextiteminthesearchlist msgid "Go to the next item in the search list" msgstr "" #: lazarusidestrconsts.rsi18noptions msgid "i18n Options" msgstr "Nastavení i18n" #: lazarusidestrconsts.rsincludeversioninfoinexecutable msgid "Include Version Info in executable" msgstr "" #: lazarusidestrconsts.rsiwpcustomposition msgid "Custom position" msgstr "Vlastní pozice" #: lazarusidestrconsts.rsiwpdefault msgid "Default" msgstr "Výchozí" #: lazarusidestrconsts.rsiwpdocked msgid "Docked" msgstr "Ukotvený" #: lazarusidestrconsts.rsiwprestorewindowgeometry msgid "Restore window geometry" msgstr "Obnovit rozměry okna" #: lazarusidestrconsts.rsiwprestorewindowsize msgid "Restore window size" msgstr "Obnovit velikost okna" #: lazarusidestrconsts.rsiwpusewindowmanagersetting msgid "Use windowmanager setting" msgstr "Uživatelské nastavení manažeru oken" #: lazarusidestrconsts.rslanguageafrikaans msgid "Afrikaans" msgstr "Afrikánština" #: lazarusidestrconsts.rslanguagearabic msgid "Arabic" msgstr "Arabština" #: lazarusidestrconsts.rslanguageautomatic msgid "Automatic (or english)" msgstr "Automaticky (nebo angličtina)" #: lazarusidestrconsts.rslanguagecatalan msgid "Catalan" msgstr "Katalánky" #: lazarusidestrconsts.rslanguagechinese msgid "Chinese" msgstr "Čínsky" #: lazarusidestrconsts.rslanguagedutch msgid "Dutch" msgstr "Němčina" #: lazarusidestrconsts.rslanguageenglish msgid "English" msgstr "Anglicky" #: lazarusidestrconsts.rslanguagefinnish msgid "Finnish" msgstr "Finsky" #: lazarusidestrconsts.rslanguagefrench msgid "French" msgstr "Francouzky" #: lazarusidestrconsts.rslanguagegerman msgid "German" msgstr "Německy" #: lazarusidestrconsts.rslanguagehebrew msgid "Hebrew" msgstr "Hebrejsky" #: lazarusidestrconsts.rslanguageindonesian msgid "Indonesian" msgstr "Indonésky" #: lazarusidestrconsts.rslanguageitalian msgid "Italian" msgstr "Italsky" #: lazarusidestrconsts.rslanguagejapanese msgid "Japanese" msgstr "Japonsky" #: lazarusidestrconsts.rslanguagelithuanian msgid "Lithuanian" msgstr "Litevsky" #: lazarusidestrconsts.rslanguageoptions msgid "Language options" msgstr "Nastavení jazyku" #: lazarusidestrconsts.rslanguagepolish msgid "Polish" msgstr "Polsky" #: lazarusidestrconsts.rslanguageportugues msgid "Portuguese" msgstr "Portugalsky" #: lazarusidestrconsts.rslanguagerussian msgid "Russian" msgstr "Rusky" #: lazarusidestrconsts.rslanguageselection msgid "Language selection:" msgstr "Výběr jazyku:" #: lazarusidestrconsts.rslanguageslovak msgid "Slovak" msgstr "Slovensky" #: lazarusidestrconsts.rslanguagespanish msgid "Spanish" msgstr "Španělsky" #: lazarusidestrconsts.rslanguageturkish msgid "Turkish" msgstr "Turecky" #: lazarusidestrconsts.rslanguageukrainian msgid "Ukrainian" msgstr "Ukrajinsky" #: lazarusidestrconsts.rsmajorrevision msgid "Major revision:" msgstr "Hlavní verze:" #: lazarusidestrconsts.rsminorrevision msgid "Minor revision:" msgstr "Minoritní verze:" #: lazarusidestrconsts.rsok msgid "ok" msgstr "ok" #: lazarusidestrconsts.rsotherinfo msgid "Other info" msgstr "Jiné informace" #: lazarusidestrconsts.rspooutputdirectory msgid "PO Output Directory:" msgstr "Výstupní adresář pro PO:" #: lazarusidestrconsts.rsremove msgid "&Remove" msgstr "&Odstranit" #: lazarusidestrconsts.rsresetfilter msgid "Reset filter" msgstr "" #: lazarusidestrconsts.rsscanners msgid "Scanners" msgstr "" #: lazarusidestrconsts.rsselectaninheritedentry msgid "Select an inherited entry" msgstr "" #: lazarusidestrconsts.rsstartanewsearch msgid "Start a new search" msgstr "" #: lazarusidestrconsts.rsversion msgid "Version:" msgstr "Verze:" #: lazarusidestrconsts.rsversionnumbering msgid "Version numbering" msgstr "Číslování verze" #: lazarusidestrconsts.srkmalreadyconnected msgid " The key \"%s\" is already connected to \"%s\"." msgstr " Klíč \"%s\" již je připojen k \"%s\"." #: lazarusidestrconsts.srkmalternkey msgid "Alternative key (or 2 keys combination)" msgstr "Alternativní klávesa (nebo kombinace dvou kláves)" #: lazarusidestrconsts.srkmcarhelpmenu msgid "Help menu commands" msgstr "Příkazy menu Nápověda" #: lazarusidestrconsts.srkmcatcmdcmd msgid "Command commands" msgstr "" #: lazarusidestrconsts.srkmcatcodetools msgid "CodeTools commands" msgstr "" #: lazarusidestrconsts.srkmcatcolselection msgid "Text column selection commands" msgstr "" #: lazarusidestrconsts.srkmcatcursormoving msgid "Cursor moving commands" msgstr "" #: lazarusidestrconsts.srkmcatediting msgid "Text editing commands" msgstr "Příkazy editace textu" #: lazarusidestrconsts.srkmcatenvmenu msgid "Environment menu commands" msgstr "Příkazy menu pro prostředí " #: lazarusidestrconsts.srkmcatfilemenu msgid "File menu commands" msgstr "Příkazy menu Soubor" #: lazarusidestrconsts.srkmcatfold msgid "Text folding commands" msgstr "" #: lazarusidestrconsts.srkmcatmarker msgid "Text marker commands" msgstr "Příkazy označení textu" #: lazarusidestrconsts.srkmcatpackagemenu msgid "Package menu commands" msgstr "Příkazy menu Balíček" #: lazarusidestrconsts.srkmcatprojectmenu msgid "Project menu commands" msgstr "Příkazy menu Projekt" #: lazarusidestrconsts.srkmcatrunmenu msgid "Run menu commands" msgstr "Spustit příkazy menu" #: lazarusidestrconsts.srkmcatsearchreplace msgid "Text search and replace commands" msgstr "Příkazy hledání a nahrazení textu" #: lazarusidestrconsts.srkmcatselection msgid "Text selection commands" msgstr "Příkazy výběru textu" #: lazarusidestrconsts.srkmcatsrcnotebook msgid "Source Notebook commands" msgstr "" #: lazarusidestrconsts.srkmcattoolmenu msgid "Tools menu commands" msgstr "Příkazy menu Nástroje" #: lazarusidestrconsts.srkmcatviewmenu msgid "View menu commands" msgstr "Zobrazit příkazy menu" #: lazarusidestrconsts.srkmcommand msgid "Command:" msgstr "Příkaz:" #: lazarusidestrconsts.srkmcommand1 msgid " command1 \"" msgstr " příkaz1 \"" #: lazarusidestrconsts.srkmcommand2 msgid " command2 \"" msgstr " příkaz2 \"" #: lazarusidestrconsts.srkmconflic msgid "Conflict " msgstr "Konflikt" #: lazarusidestrconsts.srkmconflicw msgid " conflicts with " msgstr " konflikt s " #: lazarusidestrconsts.srkmecabortbuild msgid "abort build" msgstr "přerušit sestavení" #: lazarusidestrconsts.srkmecaddjumppoint msgid "Add jump point" msgstr "Přidat bod skoku" #: lazarusidestrconsts.srkmecaddwatch msgid "add watch" msgstr "přidat sledování" #: lazarusidestrconsts.srkmecautocompletion msgid "Code template completion" msgstr "" #: lazarusidestrconsts.srkmecblockindent msgid "Indent block" msgstr "Odsadit blok" #: lazarusidestrconsts.srkmecblockunindent msgid "Unindent block" msgstr "Vrátit odsazení bloku" #: lazarusidestrconsts.srkmecbuild msgid "build program/project" msgstr "Sestavit program/projekt" #: lazarusidestrconsts.srkmecbuildall msgid "build all files of program/project" msgstr "sestavit všechny soubory programu/projektu" #: lazarusidestrconsts.srkmecbuildfile msgid "build file" msgstr "sestavit soubor" #: lazarusidestrconsts.srkmecbuildlazarus msgid "Build lazarus" msgstr "Sestavit lazarus" #: lazarusidestrconsts.srkmecchar msgid "Char" msgstr "Znak" #: lazarusidestrconsts.srkmecclearall msgid "Delete whole text" msgstr "Odstranit celý text" #: lazarusidestrconsts.srkmeccodetoolsdefinesed msgid "Codetools defines editor" msgstr "" #: lazarusidestrconsts.srkmeccodetoolsoptions msgid "Codetools options" msgstr "" #: lazarusidestrconsts.srkmeccolseldown msgid "Column Select Down" msgstr "" #: lazarusidestrconsts.srkmeccolseleditorbottom msgid "Column Select to absolute end" msgstr "" #: lazarusidestrconsts.srkmeccolseleditortop msgid "Column Select to absolute beginning" msgstr "" #: lazarusidestrconsts.srkmeccolselleft msgid "Column Select Left" msgstr "" #: lazarusidestrconsts.srkmeccolsellineend msgid "Column Select Line End" msgstr "" #: lazarusidestrconsts.srkmeccolsellinestart msgid "Column Select Line Start" msgstr "" #: lazarusidestrconsts.srkmeccolselpagebottom msgid "Column Select Page Bottom" msgstr "" #: lazarusidestrconsts.srkmeccolselpagedown msgid "Column Select Page Down" msgstr "" #: lazarusidestrconsts.srkmeccolselpagetop msgid "Column Select Page Top" msgstr "" #: lazarusidestrconsts.srkmeccolselpageup msgid "Column Select Page Up" msgstr "" #: lazarusidestrconsts.srkmeccolselright msgid "Column Select Right" msgstr "" #: lazarusidestrconsts.srkmeccolselup msgid "Column Select Up" msgstr "" #: lazarusidestrconsts.srkmeccolselwordleft msgid "Column Select Word Left" msgstr "" #: lazarusidestrconsts.srkmeccolselwordright msgid "Column Select Word Right" msgstr "" #: lazarusidestrconsts.srkmeccolumnselect msgid "Column selection mode" msgstr "Režim výběru sloupce" #: lazarusidestrconsts.srkmeccompileroptions msgid "compiler options" msgstr "volby překladače" #: lazarusidestrconsts.srkmeccompletecode msgid "Complete code" msgstr "Dokončení kódu" #: lazarusidestrconsts.srkmecconfigbuildfile msgid "config build file" msgstr "konfigurační soubor sestavení" #: lazarusidestrconsts.srkmeccopy msgid "Copy selection to clipboard" msgstr "Zkopírovat výběr do schránky" #: lazarusidestrconsts.srkmeccustomtool msgid "Custom tool %d" msgstr "" #: lazarusidestrconsts.srkmeccut msgid "Cut selection to clipboard" msgstr "Výjmout výběr do schránky" #: lazarusidestrconsts.srkmecdeletebol msgid "Delete to beginning of line" msgstr "Odstranit k začátek řádku" #: lazarusidestrconsts.srkmecdeletechar msgid "Delete char at cursor" msgstr "Odstranit znak na pozici kurzoru" #: lazarusidestrconsts.srkmecdeleteeol msgid "Delete to end of line" msgstr "Smazat ke konci řádku" #: lazarusidestrconsts.srkmecdeletelastchar msgid "Delete Last Char" msgstr "Odstratni poslední znak" #: lazarusidestrconsts.srkmecdeletelastword msgid "Delete to start of word" msgstr "Odstranit k začátku slova" #: lazarusidestrconsts.srkmecdeleteline msgid "Delete current line" msgstr "Odstranit aktuální řádek" #: lazarusidestrconsts.srkmecdeleteword msgid "Delete to end of word" msgstr "Odstranit ke konci slova" #: lazarusidestrconsts.srkmecdiff msgid "Diff" msgstr "Rozdíl" #: lazarusidestrconsts.srkmeceditorbottom msgid "Move cursor to absolute end" msgstr "" #: lazarusidestrconsts.srkmeceditortop msgid "Move cursor to absolute beginning" msgstr "" #: lazarusidestrconsts.srkmecenvironmentoptions msgid "IDE options" msgstr "" #: lazarusidestrconsts.srkmecevaluate msgid "evaluate/modify" msgstr "vyhodnocení/upravení" #: lazarusidestrconsts.srkmecextractproc msgid "Extract procedure" msgstr "" #: lazarusidestrconsts.srkmecexttool msgid "External tool %d" msgstr "Vnější nástroj %d" #: lazarusidestrconsts.srkmecexttoolsettings msgid "External tools settings" msgstr "Nastavení vnějších nástrojů" #: lazarusidestrconsts.srkmecfind msgid "Find text" msgstr "Najít text" #: lazarusidestrconsts.srkmecfindblockotherend msgid "Find block other end" msgstr "Najít další konec bloku" #: lazarusidestrconsts.srkmecfindblockstart msgid "Find block start" msgstr "Najít začátek bloku" #: lazarusidestrconsts.srkmecfinddeclaration msgid "Find declaration" msgstr "Najít deklaraci" #: lazarusidestrconsts.srkmecfindidentifierrefs msgid "Find identifier references" msgstr "" #: lazarusidestrconsts.srkmecfindinfiles msgid "Find in files" msgstr "Najít v souborech" #: lazarusidestrconsts.srkmecfindnext msgid "Find next" msgstr "Najít další" #: lazarusidestrconsts.srkmecfindnextwordoccurrence msgid "Find next word occurrence" msgstr "Najít další výskyt slova" #: lazarusidestrconsts.srkmecfindoverloads msgid "Find overloads" msgstr "" #: lazarusidestrconsts.srkmecfindprevious msgid "Find previous" msgstr "Najít předchozí" #: lazarusidestrconsts.srkmecfindprevwordoccurrence msgid "Find previous word occurrence" msgstr "Najít předchozí výskyt slova" #: lazarusidestrconsts.srkmecfindproceduredefinition msgid "Find procedure definiton" msgstr "Najít definic procedury" #: lazarusidestrconsts.srkmecfindproceduremethod msgid "Find procedure method" msgstr "" #: lazarusidestrconsts.srkmecfoldcurrent msgid "Fold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecfoldlevel msgid "Fold to Level %d" msgstr "" #: lazarusidestrconsts.srkmecgotoeditor msgid "Go to editor %d" msgstr "" #: lazarusidestrconsts.srkmecgotoincludedirective msgid "Go to to include directive of current include file" msgstr "" #: lazarusidestrconsts.srkmecgotolinenumber msgid "Go to line number" msgstr "Jít na číslo řádku" #: lazarusidestrconsts.srkmecgotomarker msgid "Go to Marker %d" msgstr "Jít na značku %d" #: lazarusidestrconsts.srkmecgotoxy msgid "Goto XY" msgstr "Jít na XY" #: lazarusidestrconsts.srkmecguessmisplacedifdef msgid "Guess misplaced $IFDEF" msgstr "" #: lazarusidestrconsts.srkmecimestr msgid "Ime Str" msgstr "" #: lazarusidestrconsts.srkmecinsertchangelogentry msgid "Insert ChangeLog entry" msgstr "" #: lazarusidestrconsts.srkmecinsertcharacter msgid "Insert from Charactermap" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsauthor msgid "Insert CVS keyword Author" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsdate msgid "Insert CVS keyword Date" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsheader msgid "Insert CVS keyword Header" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsid msgid "Insert CVS keyword ID" msgstr "" #: lazarusidestrconsts.srkmecinsertcvslog msgid "Insert CVS keyword Log" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsname msgid "Insert CVS keyword Name" msgstr "" #: lazarusidestrconsts.srkmecinsertcvsrevision msgid "Insert CVS keyword Revision" msgstr "" #: lazarusidestrconsts.srkmecinsertcvssource msgid "Insert CVS keyword Source" msgstr "" #: lazarusidestrconsts.srkmecinsertdatetime msgid "Insert current date and time" msgstr "" #: lazarusidestrconsts.srkmecinsertgplnotice msgid "Insert GPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertguid msgid "Insert a GUID" msgstr "" #: lazarusidestrconsts.srkmecinsertlgplnotice msgid "Insert LGPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertline msgid "Break line, leave cursor" msgstr "Ukončit řádek a nechat kurzor" #: lazarusidestrconsts.srkmecinsertmode msgid "Insert Mode" msgstr "Režim vkládání" #: lazarusidestrconsts.srkmecinsertmodifiedlgplnotice msgid "Insert modified LGPL notice" msgstr "" #: lazarusidestrconsts.srkmecinsertusername msgid "Insert current username" msgstr "" #: lazarusidestrconsts.srkmecinspect msgid "inspect" msgstr "" #: lazarusidestrconsts.srkmecinvertassignment msgid "Invert assignment" msgstr "" #: lazarusidestrconsts.srkmeclinebreak msgid "Break line and move cursor" msgstr "Ukončit řádek a přesunout kurzor" #: lazarusidestrconsts.srkmeclineend msgid "Move cursor to line end" msgstr "" #: lazarusidestrconsts.srkmeclineselect msgid "Line selection mode" msgstr "" #: lazarusidestrconsts.srkmeclinestart msgid "Move cursor to line start" msgstr "" #: lazarusidestrconsts.srkmecmakeresourcestring msgid "Make resource string" msgstr "" #: lazarusidestrconsts.srkmecmatchbracket msgid "Go to matching bracket" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorleft msgid "Move editor left" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorleftmost msgid "Move editor leftmost" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorright msgid "Move editor right" msgstr "" #: lazarusidestrconsts.srkmecmoveeditorrightmost msgid "Move editor rightmost" msgstr "" #: lazarusidestrconsts.srkmecnextbookmark msgid "Next Bookmark" msgstr "Další značka" #: lazarusidestrconsts.srkmecnexteditor msgid "Go to next editor" msgstr "" #: lazarusidestrconsts.srkmecnormalselect msgid "Normal selection mode" msgstr "" #: lazarusidestrconsts.srkmecopenfileatcursor msgid "Open file at cursor" msgstr "Otevřít soubor na pozici kurzoru" #: lazarusidestrconsts.srkmecoverwritemode msgid "Overwrite Mode" msgstr "Režim přepisu" #: lazarusidestrconsts.srkmecpagebottom msgid "Move cursor to bottom of page" msgstr "" #: lazarusidestrconsts.srkmecpagedown msgid "Move cursor down one page" msgstr "" #: lazarusidestrconsts.srkmecpageleft msgid "Move cursor left one page" msgstr "" #: lazarusidestrconsts.srkmecpageright msgid "Move cursor right one page" msgstr "" #: lazarusidestrconsts.srkmecpagetop msgid "Move cursor to top of page" msgstr "" #: lazarusidestrconsts.srkmecpageup msgid "Move cursor up one page" msgstr "" #: lazarusidestrconsts.srkmecpaste msgid "Paste clipboard to current position" msgstr "Vložit schránku na aktuální pozici" #: lazarusidestrconsts.srkmecpause msgid "pause program" msgstr "pozastavit program" #: lazarusidestrconsts.srkmecprevbookmark msgid "Previous Bookmark" msgstr "Předchozí značka" #: lazarusidestrconsts.srkmecpreveditor msgid "Go to prior editor" msgstr "" #: lazarusidestrconsts.srkmecprocedurelist msgid "Procedure List ..." msgstr "Seznam procedůr..." #: lazarusidestrconsts.srkmecquickcompile msgid "quick compile, no linking" msgstr "rychlý překlad, bez spojení" #: lazarusidestrconsts.srkmecremovebreakpoint msgid "remove break point" msgstr "odebrat bod přerušení" #: lazarusidestrconsts.srkmecremoveemptymethods msgid "Remove empty methods" msgstr "Odebrat prázdné metody" #: lazarusidestrconsts.srkmecremoveunusedunits msgid "Remove unused units" msgstr "" #: lazarusidestrconsts.srkmecrenameidentifier msgid "Rename identifier" msgstr "Přejmenovat identifikátor" #: lazarusidestrconsts.srkmecreplace msgid "Replace text" msgstr "Nahradit text" #: lazarusidestrconsts.srkmecresetdebugger msgid "reset debugger" msgstr "resetovat ladič" #: lazarusidestrconsts.srkmecrun msgid "run program" msgstr "spustit program" #: lazarusidestrconsts.srkmecrunfile msgid "run file" msgstr "spustit soubor" #: lazarusidestrconsts.srkmecrunparameters msgid "run parameters" msgstr "spustit s parametry" #: lazarusidestrconsts.srkmecscrolldown msgid "Scroll down one line" msgstr "" #: lazarusidestrconsts.srkmecscrollleft msgid "Scroll left one char" msgstr "" #: lazarusidestrconsts.srkmecscrollright msgid "Scroll right one char" msgstr "" #: lazarusidestrconsts.srkmecscrollup msgid "Scroll up one line" msgstr "" #: lazarusidestrconsts.srkmecseldown msgid "Select Down" msgstr "" #: lazarusidestrconsts.srkmecselectall msgid "Select All" msgstr "Vybrat vše" #: lazarusidestrconsts.srkmecselectiontabs2spaces msgid "Convert tabs to spaces in selection" msgstr "Převést ve výběru tabulátory na mezery " #: lazarusidestrconsts.srkmecseleditorbottom msgid "Select to absolute end" msgstr "" #: lazarusidestrconsts.srkmecseleditortop msgid "Select to absolute beginning" msgstr "" #: lazarusidestrconsts.srkmecselgotoxy msgid "Select Goto XY" msgstr "" #: lazarusidestrconsts.srkmecselleft msgid "SelLeft" msgstr "" #: lazarusidestrconsts.srkmecsellineend msgid "Select Line End" msgstr "" #: lazarusidestrconsts.srkmecsellinestart msgid "Select Line Start" msgstr "" #: lazarusidestrconsts.srkmecselpagebottom msgid "Select Page Bottom" msgstr "" #: lazarusidestrconsts.srkmecselpagedown msgid "Select Page Down" msgstr "" #: lazarusidestrconsts.srkmecselpageleft msgid "Select Page Left" msgstr "" #: lazarusidestrconsts.srkmecselpageright msgid "Select Page Right" msgstr "" #: lazarusidestrconsts.srkmecselpagetop msgid "Select Page Top" msgstr "" #: lazarusidestrconsts.srkmecselpageup msgid "Select Page Up" msgstr "" #: lazarusidestrconsts.srkmecselright msgid "SelRight" msgstr "" #: lazarusidestrconsts.srkmecselup msgid "Select Up" msgstr "" #: lazarusidestrconsts.srkmecselwordleft msgid "Select Word Left" msgstr "" #: lazarusidestrconsts.srkmecselwordright msgid "Select Word Right" msgstr "" #: lazarusidestrconsts.srkmecsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts.srkmecsetmarker msgid "Set Marker %d" msgstr "Nastavit značku %d" #: lazarusidestrconsts.srkmecshifttab msgid "Shift Tab" msgstr "" #: lazarusidestrconsts.srkmecshowabstractmethods msgid "Show abstract methods" msgstr "Ukázat abstraktní metody" #: lazarusidestrconsts.srkmecshowcodecontext msgid "Show code context" msgstr "Ukázat obsah kódu" #: lazarusidestrconsts.srkmecstopprogram msgid "stop program" msgstr "zastavit program" #: lazarusidestrconsts.srkmecsyntaxcheck msgid "Syntax check" msgstr "Kontrola syntaxe" #: lazarusidestrconsts.srkmectogglebreakpoint msgid "toggle break point" msgstr "" #: lazarusidestrconsts.srkmectogglebreakpoints msgid "View breakpoints" msgstr "Zobrazit body zastavení" #: lazarusidestrconsts.srkmectogglecallstack msgid "View call stack" msgstr "Zobrazit volací zásobník" #: lazarusidestrconsts.srkmectogglecodebrowser msgid "View code browser" msgstr "Zobrazit prohlížeč kódu" #: lazarusidestrconsts.srkmectogglecodeexpl msgid "View Code Explorer" msgstr "Zobrazit průzkumník kódu" #: lazarusidestrconsts.srkmectogglecomppalette msgid "View component palette" msgstr "Zobrazit sadu komponent" #: lazarusidestrconsts.srkmectoggledebuggerout msgid "View debugger output" msgstr "Zobrazit výstup ladícího nástroje" #: lazarusidestrconsts.srkmectoggleformunit msgid "Switch between form and unit" msgstr "Přepnout mezi formulářem a jednotkou" #: lazarusidestrconsts.srkmectogglefpdoceditor msgid "View Documentation Editor" msgstr "Zobrazit editor dokumentace" #: lazarusidestrconsts.srkmectoggleidespeedbtns msgid "View IDE speed buttons" msgstr "Zobrazit rychlé tlačítka IDE" #: lazarusidestrconsts.srkmectogglelocals msgid "View local variables" msgstr "Zobrazi místní proměnné" #: lazarusidestrconsts.srkmectogglemarker msgid "Toggle Marker %d" msgstr "" #: lazarusidestrconsts.srkmectogglemarkupword msgid "Toggle Current-Word highlight" msgstr "" #: lazarusidestrconsts.srkmectogglemessages msgid "View messages" msgstr "Zobrazit hlášení" #: lazarusidestrconsts.srkmectogglemode msgid "Toggle Mode" msgstr "Přepnout režim" #: lazarusidestrconsts.srkmectoggleobjectinsp msgid "View Object Inspector" msgstr "Zobrazit inspektor objektů" #: lazarusidestrconsts.srkmectogglerestrictionbrowser msgid "View restriction browser" msgstr "Zobrazit prohlížeč omezení" #: lazarusidestrconsts.srkmectogglesearchresults msgid "View Search Results" msgstr "Zobrazit výsledky hledání" #: lazarusidestrconsts.srkmectogglesourceeditor msgid "View Source Editor" msgstr "Zobrazit editor zdrojů" #: lazarusidestrconsts.srkmectogglewatches msgid "View watches" msgstr "Zobrazit sledovače" #: lazarusidestrconsts.srkmecunfoldall msgid "Unfold all" msgstr "" #: lazarusidestrconsts.srkmecunfoldcurrent msgid "Unfold at Cursor" msgstr "" #: lazarusidestrconsts.srkmecunknown msgid "unknown editor command" msgstr "neznámý příkaz editoru" #: lazarusidestrconsts.srkmecuserfirst msgid "User First" msgstr "" #: lazarusidestrconsts.srkmecviewanchoreditor msgid "View anchor editor" msgstr "Zobrazit editor kotev" #: lazarusidestrconsts.srkmecviewcomponents msgid "View components" msgstr "Zobrazit komponenty" #: lazarusidestrconsts.srkmecviewforms msgid "View forms" msgstr "Zobrazit formuláře" #: lazarusidestrconsts.srkmecviewtodolist msgid "View todo list" msgstr "Zobrazit seznam úkolů" #: lazarusidestrconsts.srkmecviewunitdependencies msgid "View unit dependencies" msgstr "Zobrazit závislosti jednotky" #: lazarusidestrconsts.srkmecviewunitinfo msgid "View unit information" msgstr "Zobrazit informace o jednotkách" #: lazarusidestrconsts.srkmecviewunits msgid "View units" msgstr "Zobrazit jednotky" #: lazarusidestrconsts.srkmecwordcompletion msgid "Word completion" msgstr "Doplnění slova" #: lazarusidestrconsts.srkmecwordleft msgid "Move cursor word left" msgstr "" #: lazarusidestrconsts.srkmecwordright msgid "Move cursor word right" msgstr "" #: lazarusidestrconsts.srkmeditforcmd msgid "Edit keys of command" msgstr "Upravit klávesy povelů" #: lazarusidestrconsts.srkmeditkeys msgid "Edit Keys" msgstr "Upravit klávesy" #: lazarusidestrconsts.srkmgrabkey msgid "Grab key" msgstr "" #: lazarusidestrconsts.srkmgrabsecondkey msgid "Grab second key" msgstr "" #: lazarusidestrconsts.srkmkey msgid "Key (or 2 keys combination)" msgstr "" #: lazarusidestrconsts.srkmpresskey msgid "Please press a key ..." msgstr "Prosím stiskněte klávesu..." #: lazarusidestrconsts.uefilerocap msgid "File is readonly" msgstr "Soubor je pouze ke čtení" #: lazarusidestrconsts.uefilerotext1 msgid "The file \"" msgstr "Soubor \"" #: lazarusidestrconsts.uefilerotext2 msgid "\" is not writable." msgstr "\" není zapisovatelný." #: lazarusidestrconsts.uemaddwatchatcursor msgid "Add &Watch At Cursor" msgstr "Přidat &Sledování v místě kurzoru" #: lazarusidestrconsts.uembookmarkn msgid "Bookmark" msgstr "Značka" #: lazarusidestrconsts.uemcloseotherpages msgid "Close All &Other Pages" msgstr "" #: lazarusidestrconsts.uemclosepage msgid "&Close Page" msgstr "&Zavřít stránku" #: lazarusidestrconsts.uemcompletecode msgid "Complete Code" msgstr "Dokončení kódu" #: lazarusidestrconsts.uemcopy msgid "Copy" msgstr "Kopírovat" #: lazarusidestrconsts.uemcopyfilename msgid "Copy Filename" msgstr "" #: lazarusidestrconsts.uemcut msgid "Cut" msgstr "Výjmout" #: lazarusidestrconsts.uemdebugword msgid "Debug" msgstr "Ladění" #: lazarusidestrconsts.uemeditorproperties msgid "Editor properties" msgstr "Vlastnosti editoru" #: lazarusidestrconsts.uemencloseselection msgid "Enclose Selection" msgstr "" #: lazarusidestrconsts.uemencoding msgid "Encoding" msgstr "Kódování" #: lazarusidestrconsts.uemextractproc msgid "Extract Procedure" msgstr "" #: lazarusidestrconsts.uemfinddeclaration msgid "&Find Declaration" msgstr "&Najít deklaraci" #: lazarusidestrconsts.uemfindidentifierreferences msgid "Find Identifier References" msgstr "" #: lazarusidestrconsts.uemgotobookmark msgid "&Goto Bookmark" msgstr "&Skok na značku" #: lazarusidestrconsts.uemhighlighter msgid "Highlighter" msgstr "Zvýrazňovač" #: lazarusidestrconsts.ueminserttodo msgid "Insert Todo" msgstr "Vložit úkol" #: lazarusidestrconsts.ueminvertassignment msgid "Invert Assignment" msgstr "Převrátit přiřazení" #: lazarusidestrconsts.uemmoveeditorleft msgid "Move Editor Left" msgstr "" #: lazarusidestrconsts.uemmoveeditorleftmost msgid "Move Editor Leftmost" msgstr "" #: lazarusidestrconsts.uemmoveeditorright msgid "Move Editor Right" msgstr "" #: lazarusidestrconsts.uemmoveeditorrightmost msgid "Move Editor Rightmost" msgstr "" #: lazarusidestrconsts.uemnextbookmark msgid "Goto next Bookmark" msgstr "" #: lazarusidestrconsts.uemodified msgid "Modified" msgstr "Změněný" #: lazarusidestrconsts.uemopenfileatcursor msgid "&Open file at cursor" msgstr "&Otevřít soubor na pozici kurzoru" #: lazarusidestrconsts.uempaste msgid "Paste" msgstr "Vložit" #: lazarusidestrconsts.uemprevbookmark msgid "Goto previous Bookmark" msgstr "" #: lazarusidestrconsts.uemprocedurejump msgid "Procedure Jump" msgstr "Skok procedury" #: lazarusidestrconsts.uemreadonly msgid "Read Only" msgstr "Pouze pro čtení" #: lazarusidestrconsts.uemrefactor msgid "Refactoring" msgstr "" #: lazarusidestrconsts.uemrenameidentifier msgid "Rename Identifier" msgstr "Přejmenovat identifikátor" #: lazarusidestrconsts.uemruntocursor msgid "&Run to Cursor" msgstr "&Spustit po kurzor" #: lazarusidestrconsts.uemsetbookmark msgid "&Set Bookmark" msgstr "&Nastavit značku" #: lazarusidestrconsts.uemsetfreebookmark msgid "Set a free Bookmark" msgstr "" #: lazarusidestrconsts.uemshowlinenumbers msgid "Show Line Numbers" msgstr "" #: lazarusidestrconsts.uemshowunitinfo msgid "Unit Info" msgstr "Informace o jednotce" #: lazarusidestrconsts.uemtogglebookmark msgid "&Toggle Bookmark" msgstr "" #: lazarusidestrconsts.uemtogglebreakpoint msgid "&Toggle Breakpoint" msgstr "" #: lazarusidestrconsts.uemviewcallstack msgid "View Call Stack" msgstr "Zobrazit volací zásobník" #: lazarusidestrconsts.uenotimplcap msgid "Not implemented yet" msgstr "Doposud neimplementováno" #: lazarusidestrconsts.uenotimplcapagain msgid "I told You: Not implemented yet" msgstr "Říkal jsem ti: Ještě není implementovano" #: lazarusidestrconsts.uenotimpltext msgid "If You can help us to implement this feature, mail to lazarus@miraclec.com" msgstr "Pošlete e-mail na lazarus@miraclec.com, pokud nám můžete pomoci implementovat tuto vlastnost." #: lazarusidestrconsts.uepins msgid "INS" msgstr "" #: lazarusidestrconsts.uepovr msgid "OVR" msgstr "" #: lazarusidestrconsts.uepreadonly msgid "Readonly" msgstr "Pouze pro čtení" #: lazarusidestrconsts.versioninfotitle msgid "Version Info" msgstr "Informace o verzi"